SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|472320795|ref|YP_007670320.1| from Polaribacter sp. MED152

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472320795|ref|YP_007670320.1|
Domain Number 1 Region: 214-410
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.49e-67
Family B3/B4 domain of PheRS, PheT 0.00001
Further Details:      
 
Domain Number 2 Region: 43-201
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.69e-42
Family Myf domain 0.0035
Further Details:      
 
Domain Number 3 Region: 482-702
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.97e-30
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0019
Further Details:      
 
Domain Number 4 Region: 711-808
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 8.89e-28
Family Anticodon-binding domain of PheRS 0.001
Further Details:      
 
Domain Number 5 Region: 419-490
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000174
Family Domains B1 and B5 of PheRS-beta, PheT 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|472320795|ref|YP_007670320.1|
Sequence length 808
Comment phenylalanyl-tRNA synthetase beta chain [Polaribacter sp. MED152]
Sequence
MKISYNWLQQFLQIDWDAVKTGELLTDLGLEVEGIETKESIKGSLKGIVIGKVLTCKQHP
NADRLKVTTVDLGDGNPVQIVCGAPNVAAGQKVPVATIGTLLYDDKGESFKIKKGKIRGE
ESHGMICAEDELGLGSSHDGIMVLDEEIKEGTLGADVFNVETDYVFEIGLTPNRSDAMSH
YGVARDLKAGLIQQDTKLELISPSVSDFHVDERTLRFDVEVEDKDLVPRYCGITITDVTV
KDSPEWIQNRLKAIGLTPKNNIVDITNYVLHELGQPLHAFDAQKIKGNKVIVKTLEEGTK
FTTLDEVERTLSADDIMICDAEENPLCIGGVFGGLNSGVTEHTNSIFLESAYFNPVSVRK
TAKRHALNTDASFRFERGIDINITEYALKRAALLIEEYAGGKLASDISDFYPVKLEDFQV
FLSYDNAYRLIGQEIPKETIKNILASLEIKINSETEGGLGLTIPSYRTDVQREADIIEEI
LRVYGYNNIEFSHKLNTSISFDSNKETKIENVVAEQLSALGFNETMANSLTKADYTKLSD
NINEEANVAMLNPLSNDLGVLRQSLLFSGLESVSYNLNRKNNALKFYEFGKTYHKYSEKY
QENKHLTLFVTGNRTKDSWNANVAQSDFFYLKGVLTSVFERLGIAKLKSTPTKNDVFSEG
LSFSLGKIKLADFGVIKRSILKEFGIKQEVLFADLNWENILQLASKKSIKVSELSKFPSV
KRDLALLLNNKTEFKEVYNLAFQSERKLLKEVDLFDVYEGDKLPEGKKSYAVSFVLQDEN
KTLEDKQIDKIMQKLQASFEKNLEAVLR
Download sequence
Identical sequences A2U2J0
gi|472320795|ref|YP_007670320.1| WP_015480055.1.7039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]