SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428211461|ref|YP_007084605.1| from Oscillatoria acuminata PCC 6304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428211461|ref|YP_007084605.1|
Domain Number 1 Region: 32-141
Classification Level Classification E-value
Superfamily RbcX-like 1.57e-40
Family RbcX-like 0.00000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428211461|ref|YP_007084605.1|
Sequence length 159
Comment RbcX protein [Oscillatoria acuminata PCC 6304]
Sequence
MVCTQRKVQPPAAIADGRHKEPPISNVANNMDLKQIAKDTAKVMSSYLTYQAMRIVVSQL
NETNPPLAYWLQNFSATANIQSGEAYIETLLQEKPDLAIRIMTVREHIAEEVTEFLPEMV
LTGIMQANIDHRKRYLERAVTGLPLADSTPETETEPGSG
Download sequence
Identical sequences K9TDS4
gi|428211461|ref|YP_007084605.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]