SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|136910|fgenesh1_kg.25_#_8_#_Locus5054v1rpkm36.49 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|136910|fgenesh1_kg.25_#_8_#_Locus5054v1rpkm36.49
Domain Number 1 Region: 5-333
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.47e-58
Family beta-Lactamase/D-ala carboxypeptidase 0.000000882
Further Details:      
 
Domain Number 2 Region: 455-550
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 2.3e-38
Family D-aminopeptidase, middle and C-terminal domains 0.0001
Further Details:      
 
Weak hits

Sequence:  jgi|Aspzo1|136910|fgenesh1_kg.25_#_8_#_Locus5054v1rpkm36.49
Domain Number - Region: 358-439
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.00115
Family D-aminopeptidase, middle and C-terminal domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|136910|fgenesh1_kg.25_#_8_#_Locus5054v1rpkm36.49
Sequence length 551
Sequence
METTKIEEILETIAVRYRGPGGAVAVLQHGAVVGQRVWGWADMNERIALTAETQMPICSI
TKQFVCALLLDLYRNPTPAMAARGEDIPQQFSDQLKELLPALFRNTANSDKLTIETLCGM
HSGLRDYWAMTTLWGAKPEDEFLVARDGPGAMARTRSLMFDTGTEYSYSNVNFYVVARAI
ERVTGEPLDQLLAERVLRPAGMKTAFLCPNTAHHPPPCVGYEGGEVAGYQAAVNRMEWAG
DAGLVASLTDMIAWEKHLETLFADPDSWYRRTVYQPQTYADGITPAHYHYGMAHVDVEGV
DSLGHGGALRGYRLHRRHAPSEHLSVVVLFNHEADASAAVDDILRAVLNRPTNSLATPTV
TASADWAGVYLDGETQLAITVTQGSREGEIKIAYAAHNAPETIKLTDPHHGRSRSMHSRI
DNDRLSIHRIIENRHLDARRLRLRDEDKSFTSHAALASIVGDYECADVDSVFHCFGEGAM
LYGAFDGYLGRGPATPMRHLGEDVWALTCPRGLDAPPPGDWTVVLRRDPAGGVTGFTIGC
WLARRLEFVKQ
Download sequence
Identical sequences A0A1L9S6I2
jgi|Aspzo1|136910|fgenesh1_kg.25_#_8_#_Locus5054v1rpkm36.49

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]