SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|143035|fgenesh1_pg.9_#_94 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|143035|fgenesh1_pg.9_#_94
Domain Number 1 Region: 71-182
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 2.35e-29
Family DRTGG domain 0.011
Further Details:      
 
Domain Number 2 Region: 181-305
Classification Level Classification E-value
Superfamily CBS-domain pair 7.56e-27
Family CBS-domain pair 0.0016
Further Details:      
 
Domain Number 3 Region: 334-431
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 0.0000000000531
Family 4HBT-like 0.04
Further Details:      
 
Weak hits

Sequence:  jgi|Aspzo1|143035|fgenesh1_pg.9_#_94
Domain Number - Region: 4-53
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00034
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|143035|fgenesh1_pg.9_#_94
Sequence length 432
Sequence
MTKHEQILDYIESLSIGSKISVRKIAKFLNVSEGTAYRAIKDADKMGMVATIDRVGTVRI
EKRNRNEIEHLTFNEIVNIIDGQVLGGNKGITKMVSKFAIGAMELKDILKYIGPKTLLIV
GNREDVQIEALKRGTAILITGGFKPSNKVINFANEHDLPVLSSSYDTFLVANIINKALFN
QKIRKDILIVQDIMTPLDDLSVLFDTMKIADYKRMANRTGHTRFPVVNESYKLVGIVTSR
EMINTKDDDEIDKVMTRNPIYVNAMSTVASCAHMMIWEGIELIPVVSSNKKTVGVINRQD
VLKSMQLLGRQPQMGETINDQIAKYITMNQDGITVEVSPLLINHYGTVSKAAFVSIIEET
IQYEMRKFKKGNVMIENLNIVYIKTVPIESHITVRFGILDVGRNFAKIEVNMHSQNDKVA
SALVICQMFDEV
Download sequence
Identical sequences A0A0E1ALX2 A0A0E1VGN4 A0A0H2WZA4 A0A0H2XHN7 A0A0H3JUI6 A0A0H3JXV9 A0A0H3JZU2 A0A0H3KH07 A0A1E8X6J8 A0A2H5APH3 A0A2K4B7M4 A0A2K4E0K4 Q2FXM2 T1YA70 W8TSS5
gi|161509918|ref|YP_001575577.1| gi|470191536|ref|YP_007577846.1| gi|387143301|ref|YP_005731694.1| gi|57652003|ref|YP_186588.1| gi|545635173|ref|YP_008585743.1| gi|470199400|ref|YP_007585800.1| 158878.SAV1705 158879.SA1527 196620.MW1648 273036.SAB1563c 282459.SAS1632 359786.SaurJH9_1761 359787.SaurJH1_1795 418127.SAHV_1691 426430.NWMN_1599 451515.SAUSA300_1651 451516.USA300HOU_1691 681288.SAAV_1714 93061.SAOUHSC_01813 93062.SACOL1752 jgi|Aspzo1|143035|fgenesh1_pg.9_#_94 gi|514066634|ref|YP_008128554.1| gi|49486530|ref|YP_043751.1| gi|479329714|ref|YP_007868773.1| gi|15927282|ref|NP_374815.1| gi|21283377|ref|NP_646465.1| gi|87160983|ref|YP_494345.1| gi|385781979|ref|YP_005758150.1| gi|384864916|ref|YP_005750275.1| gi|88195513|ref|YP_500318.1| gi|384550520|ref|YP_005739772.1| gi|15924695|ref|NP_372229.1| gi|384862302|ref|YP_005745022.1| gi|387150848|ref|YP_005742412.1| WP_000160435.1.100013 WP_000160435.1.100041 WP_000160435.1.100057 WP_000160435.1.10006 WP_000160435.1.100067 WP_000160435.1.100072 WP_000160435.1.100075 WP_000160435.1.100084 WP_000160435.1.100088 WP_000160435.1.100090 WP_000160435.1.100094 WP_000160435.1.100096 WP_000160435.1.100117 WP_000160435.1.100122 WP_000160435.1.10014 WP_000160435.1.100171 WP_000160435.1.100180 WP_000160435.1.100184 WP_000160435.1.100189 WP_000160435.1.100235 WP_000160435.1.100298 WP_000160435.1.100307 WP_000160435.1.100310 WP_000160435.1.10032 WP_000160435.1.100335 WP_000160435.1.100352 WP_000160435.1.100357 WP_000160435.1.100366 WP_000160435.1.100384 WP_000160435.1.100391 WP_000160435.1.100399 WP_000160435.1.10041 WP_000160435.1.10046 WP_000160435.1.100464 WP_000160435.1.10050 WP_000160435.1.100507 WP_000160435.1.100527 WP_000160435.1.100535 WP_000160435.1.100560 WP_000160435.1.100562 WP_000160435.1.100582 WP_000160435.1.100596 WP_000160435.1.100604 WP_000160435.1.100612 WP_000160435.1.100613 WP_000160435.1.100618 WP_000160435.1.100631 WP_000160435.1.100647 WP_000160435.1.100665 WP_000160435.1.100668 WP_000160435.1.100693 WP_000160435.1.100699 WP_000160435.1.100704 WP_000160435.1.100719 WP_000160435.1.100761 WP_000160435.1.100768 WP_000160435.1.100785 WP_000160435.1.100823 WP_000160435.1.100832 WP_000160435.1.100834 WP_000160435.1.10085 WP_000160435.1.100860 WP_000160435.1.100888 WP_000160435.1.1009 WP_000160435.1.100903 WP_000160435.1.100920 WP_000160435.1.100922 WP_000160435.1.100934 WP_000160435.1.100956 WP_000160435.1.100963 WP_000160435.1.10097 WP_000160435.1.100981 WP_000160435.1.100986 WP_000160435.1.100987 WP_000160435.1.101002 WP_000160435.1.101017 WP_000160435.1.101019 WP_000160435.1.101023 WP_000160435.1.101027 WP_000160435.1.101058 WP_000160435.1.101068 WP_000160435.1.101071 WP_000160435.1.101072 WP_000160435.1.101084 WP_000160435.1.101103 WP_000160435.1.10111 WP_000160435.1.101160 WP_000160435.1.101177 WP_000160435.1.101192 WP_000160435.1.101240 WP_000160435.1.101262 WP_000160435.1.101266 WP_000160435.1.101298 WP_000160435.1.101327 WP_000160435.1.101329 WP_000160435.1.101355 WP_000160435.1.101375 WP_000160435.1.101379 WP_000160435.1.101393 WP_000160435.1.101397 WP_000160435.1.101402 WP_000160435.1.101406 WP_000160435.1.101414 WP_000160435.1.101440 WP_000160435.1.101441 WP_000160435.1.10148 WP_000160435.1.101490 WP_000160435.1.1015 WP_000160435.1.101505 WP_000160435.1.101511 WP_000160435.1.101566 WP_000160435.1.101567 WP_000160435.1.101570 WP_000160435.1.101598 WP_000160435.1.101615 WP_000160435.1.101617 WP_000160435.1.101619 WP_000160435.1.101627 WP_000160435.1.101645 WP_000160435.1.10165 WP_000160435.1.101657 WP_000160435.1.10166 WP_000160435.1.101661 WP_000160435.1.101691 WP_000160435.1.101704 WP_000160435.1.101716 WP_000160435.1.101725 WP_000160435.1.101728 WP_000160435.1.101731 WP_000160435.1.101745 WP_000160435.1.101757 WP_000160435.1.101778 WP_000160435.1.101779 WP_000160435.1.101788 WP_000160435.1.101813 WP_000160435.1.101820 WP_000160435.1.101824 WP_000160435.1.101825 WP_000160435.1.101831 WP_000160435.1.101852 WP_000160435.1.101902 WP_000160435.1.101906 WP_000160435.1.101921 WP_000160435.1.101943 WP_000160435.1.101950 WP_000160435.1.102064 WP_000160435.1.102065 WP_000160435.1.102066 WP_000160435.1.102096 WP_000160435.1.102123 WP_000160435.1.102130 WP_000160435.1.102132 WP_000160435.1.10214 WP_000160435.1.1022 WP_000160435.1.10232 WP_000160435.1.10238 WP_000160435.1.10240 WP_000160435.1.10244 WP_000160435.1.10249 WP_000160435.1.1025 WP_000160435.1.10274 WP_000160435.1.10292 WP_000160435.1.10294 WP_000160435.1.10301 WP_000160435.1.10306 WP_000160435.1.1031 WP_000160435.1.10321 WP_000160435.1.10343 WP_000160435.1.10355 WP_000160435.1.10397 WP_000160435.1.1043 WP_000160435.1.10431 WP_000160435.1.10436 WP_000160435.1.10450 WP_000160435.1.10478 WP_000160435.1.10481 WP_000160435.1.10486 WP_000160435.1.10503 WP_000160435.1.1052 WP_000160435.1.10526 WP_000160435.1.10542 WP_000160435.1.10543 WP_000160435.1.10565 WP_000160435.1.10583 WP_000160435.1.10614 WP_000160435.1.10624 WP_000160435.1.10644 WP_000160435.1.10664 WP_000160435.1.10679 WP_000160435.1.10707 WP_000160435.1.10726 WP_000160435.1.10742 WP_000160435.1.10749 WP_000160435.1.10751 WP_000160435.1.1077 WP_000160435.1.10783 WP_000160435.1.10823 WP_000160435.1.10841 WP_000160435.1.10858 WP_000160435.1.1087 WP_000160435.1.10917 WP_000160435.1.10919 WP_000160435.1.10928 WP_000160435.1.10942 WP_000160435.1.10950 WP_000160435.1.10965 WP_000160435.1.1097 WP_000160435.1.10976 WP_000160435.1.10979 WP_000160435.1.10985 WP_000160435.1.10986 WP_000160435.1.11001 WP_000160435.1.11067 WP_000160435.1.11069 WP_000160435.1.11073 WP_000160435.1.11074 WP_000160435.1.11076 WP_000160435.1.11083 WP_000160435.1.11084 WP_000160435.1.11129 WP_000160435.1.1115 WP_000160435.1.11162 WP_000160435.1.11184 WP_000160435.1.1120 WP_000160435.1.11202 WP_000160435.1.11220 WP_000160435.1.11234 WP_000160435.1.11261 WP_000160435.1.11282 WP_000160435.1.11286 WP_000160435.1.11287 WP_000160435.1.11294 WP_000160435.1.11312 WP_000160435.1.11322 WP_000160435.1.11333 WP_000160435.1.11348 WP_000160435.1.11353 WP_000160435.1.1136 WP_000160435.1.11365 WP_000160435.1.11377 WP_000160435.1.11378 WP_000160435.1.11391 WP_000160435.1.11403 WP_000160435.1.11407 WP_000160435.1.11434 WP_000160435.1.11441 WP_000160435.1.11447 WP_000160435.1.11451 WP_000160435.1.11463 WP_000160435.1.1147 WP_000160435.1.11488 WP_000160435.1.11492 WP_000160435.1.11494 WP_000160435.1.11504 WP_000160435.1.1151 WP_000160435.1.11513 WP_000160435.1.1152 WP_000160435.1.11525 WP_000160435.1.11540 WP_000160435.1.11556 WP_000160435.1.11558 WP_000160435.1.11571 WP_000160435.1.11580 WP_000160435.1.11592 WP_000160435.1.11611 WP_000160435.1.11625 WP_000160435.1.11640 WP_000160435.1.11646 WP_000160435.1.11655 WP_000160435.1.11663 WP_000160435.1.11665 WP_000160435.1.11692 WP_000160435.1.117 WP_000160435.1.1171 WP_000160435.1.11719 WP_000160435.1.11720 WP_000160435.1.11723 WP_000160435.1.11730 WP_000160435.1.11736 WP_000160435.1.11768 WP_000160435.1.11794 WP_000160435.1.11795 WP_000160435.1.11816 WP_000160435.1.11828 WP_000160435.1.11829 WP_000160435.1.11837 WP_000160435.1.11884 WP_000160435.1.11903 WP_000160435.1.11904 WP_000160435.1.11969 WP_000160435.1.11991 WP_000160435.1.12005 WP_000160435.1.12019 WP_000160435.1.12026 WP_000160435.1.12029 WP_000160435.1.12042 WP_000160435.1.1205 WP_000160435.1.12073 WP_000160435.1.12098 WP_000160435.1.1210 WP_000160435.1.12123 WP_000160435.1.1213 WP_000160435.1.12149 WP_000160435.1.12152 WP_000160435.1.12170 WP_000160435.1.12175 WP_000160435.1.12179 WP_000160435.1.12181 WP_000160435.1.12193 WP_000160435.1.12194 WP_000160435.1.12201 WP_000160435.1.12226 WP_000160435.1.12233 WP_000160435.1.12234 WP_000160435.1.12256 WP_000160435.1.12272 WP_000160435.1.12297 WP_000160435.1.12328 WP_000160435.1.12330 WP_000160435.1.12361 WP_000160435.1.12366 WP_000160435.1.12436 WP_000160435.1.12437 WP_000160435.1.12447 WP_000160435.1.12498 WP_000160435.1.12508 WP_000160435.1.12516 WP_000160435.1.1252 WP_000160435.1.1257 WP_000160435.1.12597 WP_000160435.1.12598 WP_000160435.1.12608 WP_000160435.1.12618 WP_000160435.1.12639 WP_000160435.1.12685 WP_000160435.1.12711 WP_000160435.1.12715 WP_000160435.1.12733 WP_000160435.1.12737 WP_000160435.1.1276 WP_000160435.1.12770 WP_000160435.1.12771 WP_000160435.1.12772 WP_000160435.1.12780 WP_000160435.1.12788 WP_000160435.1.12822 WP_000160435.1.12829 WP_000160435.1.12833 WP_000160435.1.12845 WP_000160435.1.12858 WP_000160435.1.12862 WP_000160435.1.12884 WP_000160435.1.12886 WP_000160435.1.12903 WP_000160435.1.12904 WP_000160435.1.12918 WP_000160435.1.12920 WP_000160435.1.12938 WP_000160435.1.12977 WP_000160435.1.13013 WP_000160435.1.13039 WP_000160435.1.13062 WP_000160435.1.13072 WP_000160435.1.13091 WP_000160435.1.13104 WP_000160435.1.13154 WP_000160435.1.13164 WP_000160435.1.13169 WP_000160435.1.13189 WP_000160435.1.13228 WP_000160435.1.13243 WP_000160435.1.13250 WP_000160435.1.13303 WP_000160435.1.13326 WP_000160435.1.13336 WP_000160435.1.13355 WP_000160435.1.13379 WP_000160435.1.13381 WP_000160435.1.13405 WP_000160435.1.13448 WP_000160435.1.13468 WP_000160435.1.1347 WP_000160435.1.13486 WP_000160435.1.13501 WP_000160435.1.13514 WP_000160435.1.13531 WP_000160435.1.13532 WP_000160435.1.1355 WP_000160435.1.13554 WP_000160435.1.13556 WP_000160435.1.13557 WP_000160435.1.13568 WP_000160435.1.13598 WP_000160435.1.13612 WP_000160435.1.13617 WP_000160435.1.13650 WP_000160435.1.13654 WP_000160435.1.13665 WP_000160435.1.13668 WP_000160435.1.13670 WP_000160435.1.13680 WP_000160435.1.13683 WP_000160435.1.13696 WP_000160435.1.13726 WP_000160435.1.13727 WP_000160435.1.13733 WP_000160435.1.13734 WP_000160435.1.1374 WP_000160435.1.1375 WP_000160435.1.13755 WP_000160435.1.13757 WP_000160435.1.13772 WP_000160435.1.13787 WP_000160435.1.13804 WP_000160435.1.13805 WP_000160435.1.13831 WP_000160435.1.13879 WP_000160435.1.13897 WP_000160435.1.13904 WP_000160435.1.13914 WP_000160435.1.13933 WP_000160435.1.13940 WP_000160435.1.13947 WP_000160435.1.13983 WP_000160435.1.13986 WP_000160435.1.13987 WP_000160435.1.14010 WP_000160435.1.14025 WP_000160435.1.14034 WP_000160435.1.14071 WP_000160435.1.14076 WP_000160435.1.14097 WP_000160435.1.14112 WP_000160435.1.14143 WP_000160435.1.14153 WP_000160435.1.14163 WP_000160435.1.14192 WP_000160435.1.1420 WP_000160435.1.14201 WP_000160435.1.14233 WP_000160435.1.1425 WP_000160435.1.1426 WP_000160435.1.14281 WP_000160435.1.1429 WP_000160435.1.14302 WP_000160435.1.14305 WP_000160435.1.14342 WP_000160435.1.14355 WP_000160435.1.14358 WP_000160435.1.14364 WP_000160435.1.14365 WP_000160435.1.14366 WP_000160435.1.14372 WP_000160435.1.14394 WP_000160435.1.14397 WP_000160435.1.14412 WP_000160435.1.14418 WP_000160435.1.14475 WP_000160435.1.14535 WP_000160435.1.14546 WP_000160435.1.1457 WP_000160435.1.14577 WP_000160435.1.14590 WP_000160435.1.14596 WP_000160435.1.14639 WP_000160435.1.14666 WP_000160435.1.1468 WP_000160435.1.14696 WP_000160435.1.147 WP_000160435.1.1471 WP_000160435.1.14729 WP_000160435.1.14734 WP_000160435.1.14744 WP_000160435.1.1477 WP_000160435.1.14774 WP_000160435.1.14782 WP_000160435.1.14790 WP_000160435.1.14809 WP_000160435.1.14823 WP_000160435.1.14825 WP_000160435.1.14846 WP_000160435.1.14866 WP_000160435.1.14868 WP_000160435.1.14869 WP_000160435.1.14874 WP_000160435.1.14888 WP_000160435.1.1490 WP_000160435.1.14902 WP_000160435.1.14924 WP_000160435.1.14967 WP_000160435.1.14970 WP_000160435.1.14987 WP_000160435.1.15000 WP_000160435.1.15015 WP_000160435.1.15022 WP_000160435.1.15029 WP_000160435.1.15039 WP_000160435.1.15091 WP_000160435.1.15098 WP_000160435.1.15108 WP_000160435.1.15173 WP_000160435.1.15182 WP_000160435.1.15185 WP_000160435.1.1520 WP_000160435.1.15201 WP_000160435.1.15228 WP_000160435.1.15234 WP_000160435.1.15241 WP_000160435.1.1525 WP_000160435.1.15255 WP_000160435.1.15263 WP_000160435.1.15268 WP_000160435.1.15269 WP_000160435.1.15278 WP_000160435.1.15294 WP_000160435.1.15296 WP_000160435.1.15329 WP_000160435.1.15389 WP_000160435.1.15399 WP_000160435.1.15403 WP_000160435.1.15409 WP_000160435.1.15421 WP_000160435.1.15438 WP_000160435.1.1545 WP_000160435.1.15478 WP_000160435.1.15489 WP_000160435.1.15505 WP_000160435.1.15507 WP_000160435.1.15519 WP_000160435.1.15524 WP_000160435.1.15533 WP_000160435.1.15544 WP_000160435.1.15554 WP_000160435.1.15572 WP_000160435.1.1558 WP_000160435.1.15590 WP_000160435.1.15601 WP_000160435.1.1562 WP_000160435.1.1564 WP_000160435.1.15687 WP_000160435.1.1569 WP_000160435.1.15691 WP_000160435.1.15706 WP_000160435.1.15722 WP_000160435.1.15753 WP_000160435.1.15785 WP_000160435.1.1579 WP_000160435.1.15812 WP_000160435.1.15818 WP_000160435.1.1583 WP_000160435.1.15838 WP_000160435.1.1586 WP_000160435.1.15883 WP_000160435.1.15892 WP_000160435.1.15897 WP_000160435.1.15898 WP_000160435.1.159 WP_000160435.1.15920 WP_000160435.1.15925 WP_000160435.1.15928 WP_000160435.1.15939 WP_000160435.1.15957 WP_000160435.1.15972 WP_000160435.1.1599 WP_000160435.1.1600 WP_000160435.1.16018 WP_000160435.1.1606 WP_000160435.1.16068 WP_000160435.1.16095 WP_000160435.1.16096 WP_000160435.1.16098 WP_000160435.1.16112 WP_000160435.1.16114 WP_000160435.1.16140 WP_000160435.1.16173 WP_000160435.1.16195 WP_000160435.1.16203 WP_000160435.1.16213 WP_000160435.1.16223 WP_000160435.1.1623 WP_000160435.1.16237 WP_000160435.1.16251 WP_000160435.1.16265 WP_000160435.1.16276 WP_000160435.1.16283 WP_000160435.1.16311 WP_000160435.1.16362 WP_000160435.1.16372 WP_000160435.1.16395 WP_000160435.1.16407 WP_000160435.1.16417 WP_000160435.1.16433 WP_000160435.1.16455 WP_000160435.1.16458 WP_000160435.1.16467 WP_000160435.1.16554 WP_000160435.1.16569 WP_000160435.1.16589 WP_000160435.1.16603 WP_000160435.1.16606 WP_000160435.1.16617 WP_000160435.1.1662 WP_000160435.1.16628 WP_000160435.1.16632 WP_000160435.1.16649 WP_000160435.1.1665 WP_000160435.1.16651 WP_000160435.1.16653 WP_000160435.1.16664 WP_000160435.1.16672 WP_000160435.1.16679 WP_000160435.1.16684 WP_000160435.1.16688 WP_000160435.1.16693 WP_000160435.1.16703 WP_000160435.1.16747 WP_000160435.1.16757 WP_000160435.1.16761 WP_000160435.1.16762 WP_000160435.1.16768 WP_000160435.1.16770 WP_000160435.1.16776 WP_000160435.1.16794 WP_000160435.1.16815 WP_000160435.1.16824 WP_000160435.1.16833 WP_000160435.1.16880 WP_000160435.1.16882 WP_000160435.1.16892 WP_000160435.1.16920 WP_000160435.1.16925 WP_000160435.1.16936 WP_000160435.1.16938 WP_000160435.1.16946 WP_000160435.1.16969 WP_000160435.1.16986 WP_000160435.1.17012 WP_000160435.1.17038 WP_000160435.1.17046 WP_000160435.1.17080 WP_000160435.1.17104 WP_000160435.1.17122 WP_000160435.1.17132 WP_000160435.1.17137 WP_000160435.1.17139 WP_000160435.1.17156 WP_000160435.1.17157 WP_000160435.1.17169 WP_000160435.1.17180 WP_000160435.1.17193 WP_000160435.1.17200 WP_000160435.1.17210 WP_000160435.1.17231 WP_000160435.1.17234 WP_000160435.1.17240 WP_000160435.1.17248 WP_000160435.1.17249 WP_000160435.1.1725 WP_000160435.1.17256 WP_000160435.1.17289 WP_000160435.1.1729 WP_000160435.1.17296 WP_000160435.1.17309 WP_000160435.1.17320 WP_000160435.1.17327 WP_000160435.1.1736 WP_000160435.1.1740 WP_000160435.1.1741 WP_000160435.1.17419 WP_000160435.1.17450 WP_000160435.1.17454 WP_000160435.1.17456 WP_000160435.1.17475 WP_000160435.1.17485 WP_000160435.1.1751 WP_000160435.1.17520 WP_000160435.1.17526 WP_000160435.1.17529 WP_000160435.1.17531 WP_000160435.1.1756 WP_000160435.1.17581 WP_000160435.1.17590 WP_000160435.1.17628 WP_000160435.1.17643 WP_000160435.1.1765 WP_000160435.1.17650 WP_000160435.1.17651 WP_000160435.1.17657 WP_000160435.1.17658 WP_000160435.1.17666 WP_000160435.1.17671 WP_000160435.1.17676 WP_000160435.1.1771 WP_000160435.1.17717 WP_000160435.1.17718 WP_000160435.1.17720 WP_000160435.1.17725 WP_000160435.1.17729 WP_000160435.1.17737 WP_000160435.1.17770 WP_000160435.1.17796 WP_000160435.1.17818 WP_000160435.1.17832 WP_000160435.1.17834 WP_000160435.1.17835 WP_000160435.1.17838 WP_000160435.1.17845 WP_000160435.1.17853 WP_000160435.1.17859 WP_000160435.1.1787 WP_000160435.1.17876 WP_000160435.1.17882 WP_000160435.1.17909 WP_000160435.1.17922 WP_000160435.1.17929 WP_000160435.1.17943 WP_000160435.1.17951 WP_000160435.1.17966 WP_000160435.1.17987 WP_000160435.1.18011 WP_000160435.1.18016 WP_000160435.1.18035 WP_000160435.1.18069 WP_000160435.1.18074 WP_000160435.1.18080 WP_000160435.1.18105 WP_000160435.1.18113 WP_000160435.1.18140 WP_000160435.1.18153 WP_000160435.1.18197 WP_000160435.1.18203 WP_000160435.1.18205 WP_000160435.1.18237 WP_000160435.1.18248 WP_000160435.1.18261 WP_000160435.1.18273 WP_000160435.1.18283 WP_000160435.1.18288 WP_000160435.1.1829 WP_000160435.1.18290 WP_000160435.1.18301 WP_000160435.1.18309 WP_000160435.1.18310 WP_000160435.1.18320 WP_000160435.1.18346 WP_000160435.1.1835 WP_000160435.1.18360 WP_000160435.1.18412 WP_000160435.1.18424 WP_000160435.1.18429 WP_000160435.1.18437 WP_000160435.1.18451 WP_000160435.1.18466 WP_000160435.1.1847 WP_000160435.1.18487 WP_000160435.1.18497 WP_000160435.1.185 WP_000160435.1.18504 WP_000160435.1.18506 WP_000160435.1.18507 WP_000160435.1.1851 WP_000160435.1.18516 WP_000160435.1.18527 WP_000160435.1.18529 WP_000160435.1.18538 WP_000160435.1.18539 WP_000160435.1.18545 WP_000160435.1.18560 WP_000160435.1.18562 WP_000160435.1.18566 WP_000160435.1.18567 WP_000160435.1.18570 WP_000160435.1.18591 WP_000160435.1.18611 WP_000160435.1.18627 WP_000160435.1.18632 WP_000160435.1.18668 WP_000160435.1.18679 WP_000160435.1.18741 WP_000160435.1.18758 WP_000160435.1.18763 WP_000160435.1.18774 WP_000160435.1.18777 WP_000160435.1.18779 WP_000160435.1.18792 WP_000160435.1.18809 WP_000160435.1.18818 WP_000160435.1.18830 WP_000160435.1.18834 WP_000160435.1.18836 WP_000160435.1.18879 WP_000160435.1.18882 WP_000160435.1.18918 WP_000160435.1.1892 WP_000160435.1.18938 WP_000160435.1.18965 WP_000160435.1.18968 WP_000160435.1.18974 WP_000160435.1.18987 WP_000160435.1.18996 WP_000160435.1.19009 WP_000160435.1.1901 WP_000160435.1.19022 WP_000160435.1.19027 WP_000160435.1.19052 WP_000160435.1.19082 WP_000160435.1.1911 WP_000160435.1.19149 WP_000160435.1.19179 WP_000160435.1.192 WP_000160435.1.19259 WP_000160435.1.19272 WP_000160435.1.19301 WP_000160435.1.19322 WP_000160435.1.19365 WP_000160435.1.19386 WP_000160435.1.19390 WP_000160435.1.19399 WP_000160435.1.1940 WP_000160435.1.19411 WP_000160435.1.19430 WP_000160435.1.19444 WP_000160435.1.19450 WP_000160435.1.19455 WP_000160435.1.19497 WP_000160435.1.19509 WP_000160435.1.19515 WP_000160435.1.19537 WP_000160435.1.19555 WP_000160435.1.19575 WP_000160435.1.19577 WP_000160435.1.1964 WP_000160435.1.19643 WP_000160435.1.19653 WP_000160435.1.19701 WP_000160435.1.19717 WP_000160435.1.19725 WP_000160435.1.19732 WP_000160435.1.19733 WP_000160435.1.1974 WP_000160435.1.19748 WP_000160435.1.1975 WP_000160435.1.19765 WP_000160435.1.19775 WP_000160435.1.19788 WP_000160435.1.19792 WP_000160435.1.19801 WP_000160435.1.19807 WP_000160435.1.19816 WP_000160435.1.19848 WP_000160435.1.19853 WP_000160435.1.19891 WP_000160435.1.19904 WP_000160435.1.19905 WP_000160435.1.19912 WP_000160435.1.19921 WP_000160435.1.19968 WP_000160435.1.19977 WP_000160435.1.19980 WP_000160435.1.19981 WP_000160435.1.19982 WP_000160435.1.2 WP_000160435.1.20006 WP_000160435.1.20049 WP_000160435.1.20052 WP_000160435.1.20057 WP_000160435.1.2007 WP_000160435.1.20078 WP_000160435.1.2008 WP_000160435.1.20090 WP_000160435.1.20100 WP_000160435.1.20101 WP_000160435.1.2013 WP_000160435.1.20155 WP_000160435.1.20156 WP_000160435.1.20160 WP_000160435.1.20161 WP_000160435.1.20167 WP_000160435.1.20177 WP_000160435.1.20191 WP_000160435.1.20210 WP_000160435.1.20214 WP_000160435.1.20219 WP_000160435.1.20221 WP_000160435.1.20235 WP_000160435.1.20245 WP_000160435.1.2025 WP_000160435.1.20265 WP_000160435.1.2029 WP_000160435.1.20324 WP_000160435.1.20340 WP_000160435.1.20354 WP_000160435.1.20358 WP_000160435.1.20386 WP_000160435.1.20394 WP_000160435.1.20398 WP_000160435.1.20399 WP_000160435.1.20411 WP_000160435.1.20447 WP_000160435.1.20473 WP_000160435.1.20479 WP_000160435.1.20487 WP_000160435.1.20500 WP_000160435.1.20512 WP_000160435.1.20550 WP_000160435.1.20554 WP_000160435.1.2056 WP_000160435.1.20574 WP_000160435.1.20579 WP_000160435.1.20585 WP_000160435.1.20598 WP_000160435.1.20611 WP_000160435.1.20618 WP_000160435.1.20619 WP_000160435.1.20620 WP_000160435.1.20649 WP_000160435.1.20661 WP_000160435.1.20690 WP_000160435.1.20698 WP_000160435.1.20736 WP_000160435.1.20772 WP_000160435.1.20796 WP_000160435.1.20821 WP_000160435.1.20833 WP_000160435.1.20838 WP_000160435.1.20846 WP_000160435.1.20860 WP_000160435.1.20866 WP_000160435.1.20867 WP_000160435.1.20878 WP_000160435.1.20906 WP_000160435.1.20913 WP_000160435.1.20922 WP_000160435.1.20935 WP_000160435.1.20939 WP_000160435.1.20945 WP_000160435.1.20971 WP_000160435.1.20975 WP_000160435.1.21009 WP_000160435.1.21013 WP_000160435.1.21015 WP_000160435.1.21031 WP_000160435.1.21036 WP_000160435.1.21054 WP_000160435.1.21056 WP_000160435.1.21066 WP_000160435.1.21078 WP_000160435.1.21080 WP_000160435.1.21081 WP_000160435.1.21109 WP_000160435.1.21111 WP_000160435.1.21140 WP_000160435.1.21154 WP_000160435.1.21183 WP_000160435.1.2119 WP_000160435.1.21222 WP_000160435.1.21257 WP_000160435.1.21259 WP_000160435.1.21272 WP_000160435.1.2129 WP_000160435.1.21312 WP_000160435.1.21313 WP_000160435.1.21314 WP_000160435.1.21330 WP_000160435.1.21339 WP_000160435.1.2135 WP_000160435.1.21356 WP_000160435.1.21359 WP_000160435.1.21375 WP_000160435.1.21379 WP_000160435.1.21386 WP_000160435.1.21393 WP_000160435.1.21402 WP_000160435.1.21412 WP_000160435.1.21416 WP_000160435.1.21449 WP_000160435.1.21458 WP_000160435.1.21464 WP_000160435.1.21465 WP_000160435.1.21477 WP_000160435.1.21480 WP_000160435.1.21500 WP_000160435.1.21505 WP_000160435.1.21511 WP_000160435.1.21514 WP_000160435.1.2154 WP_000160435.1.21572 WP_000160435.1.21583 WP_000160435.1.21589 WP_000160435.1.2159 WP_000160435.1.2160 WP_000160435.1.21601 WP_000160435.1.21621 WP_000160435.1.21679 WP_000160435.1.21712 WP_000160435.1.21719 WP_000160435.1.21724 WP_000160435.1.21746 WP_000160435.1.21763 WP_000160435.1.2178 WP_000160435.1.21787 WP_000160435.1.21820 WP_000160435.1.21828 WP_000160435.1.21830 WP_000160435.1.21890 WP_000160435.1.21900 WP_000160435.1.21901 WP_000160435.1.21985 WP_000160435.1.21988 WP_000160435.1.2200 WP_000160435.1.22000 WP_000160435.1.22011 WP_000160435.1.22027 WP_000160435.1.22033 WP_000160435.1.22038 WP_000160435.1.22045 WP_000160435.1.22049 WP_000160435.1.22065 WP_000160435.1.22082 WP_000160435.1.22111 WP_000160435.1.22149 WP_000160435.1.22163 WP_000160435.1.22164 WP_000160435.1.22165 WP_000160435.1.22170 WP_000160435.1.22174 WP_000160435.1.22177 WP_000160435.1.22180 WP_000160435.1.22197 WP_000160435.1.22227 WP_000160435.1.22246 WP_000160435.1.22302 WP_000160435.1.22307 WP_000160435.1.22332 WP_000160435.1.22351 WP_000160435.1.22367 WP_000160435.1.22400 WP_000160435.1.22419 WP_000160435.1.22426 WP_000160435.1.22441 WP_000160435.1.22493 WP_000160435.1.22498 WP_000160435.1.22526 WP_000160435.1.22531 WP_000160435.1.22533 WP_000160435.1.22547 WP_000160435.1.22551 WP_000160435.1.22559 WP_000160435.1.22650 WP_000160435.1.22657 WP_000160435.1.22684 WP_000160435.1.22696 WP_000160435.1.22702 WP_000160435.1.22709 WP_000160435.1.22714 WP_000160435.1.22730 WP_000160435.1.22731 WP_000160435.1.22738 WP_000160435.1.22764 WP_000160435.1.22789 WP_000160435.1.22790 WP_000160435.1.22792 WP_000160435.1.2280 WP_000160435.1.22803 WP_000160435.1.22808 WP_000160435.1.22811 WP_000160435.1.22826 WP_000160435.1.22843 WP_000160435.1.22853 WP_000160435.1.22861 WP_000160435.1.22869 WP_000160435.1.22890 WP_000160435.1.22924 WP_000160435.1.22969 WP_000160435.1.22983 WP_000160435.1.22984 WP_000160435.1.22994 WP_000160435.1.23008 WP_000160435.1.23012 WP_000160435.1.23048 WP_000160435.1.23061 WP_000160435.1.23082 WP_000160435.1.23103 WP_000160435.1.23121 WP_000160435.1.23130 WP_000160435.1.23132 WP_000160435.1.23133 WP_000160435.1.23146 WP_000160435.1.23152 WP_000160435.1.23161 WP_000160435.1.23185 WP_000160435.1.23194 WP_000160435.1.23197 WP_000160435.1.23222 WP_000160435.1.23228 WP_000160435.1.23238 WP_000160435.1.23244 WP_000160435.1.23251 WP_000160435.1.2327 WP_000160435.1.23275 WP_000160435.1.23288 WP_000160435.1.23304 WP_000160435.1.23381 WP_000160435.1.23413 WP_000160435.1.23420 WP_000160435.1.23431 WP_000160435.1.23439 WP_000160435.1.23449 WP_000160435.1.23476 WP_000160435.1.23489 WP_000160435.1.23491 WP_000160435.1.23517 WP_000160435.1.23531 WP_000160435.1.23541 WP_000160435.1.23544 WP_000160435.1.23572 WP_000160435.1.23580 WP_000160435.1.23613 WP_000160435.1.23617 WP_000160435.1.23626 WP_000160435.1.23630 WP_000160435.1.23644 WP_000160435.1.2365 WP_000160435.1.23671 WP_000160435.1.23690 WP_000160435.1.23708 WP_000160435.1.23710 WP_000160435.1.23730 WP_000160435.1.23740 WP_000160435.1.23796 WP_000160435.1.23809 WP_000160435.1.23822 WP_000160435.1.23842 WP_000160435.1.23849 WP_000160435.1.2389 WP_000160435.1.23900 WP_000160435.1.23902 WP_000160435.1.23907 WP_000160435.1.23926 WP_000160435.1.23935 WP_000160435.1.23944 WP_000160435.1.23956 WP_000160435.1.23972 WP_000160435.1.23995 WP_000160435.1.23998 WP_000160435.1.24000 WP_000160435.1.24081 WP_000160435.1.24129 WP_000160435.1.24148 WP_000160435.1.24154 WP_000160435.1.24167 WP_000160435.1.24174 WP_000160435.1.24207 WP_000160435.1.24213 WP_000160435.1.24226 WP_000160435.1.2423 WP_000160435.1.24241 WP_000160435.1.24263 WP_000160435.1.2427 WP_000160435.1.24276 WP_000160435.1.24277 WP_000160435.1.24279 WP_000160435.1.24286 WP_000160435.1.24302 WP_000160435.1.2434 WP_000160435.1.24343 WP_000160435.1.24364 WP_000160435.1.24365 WP_000160435.1.24416 WP_000160435.1.24418 WP_000160435.1.2442 WP_000160435.1.24437 WP_000160435.1.24443 WP_000160435.1.24462 WP_000160435.1.24478 WP_000160435.1.2450 WP_000160435.1.24503 WP_000160435.1.24519 WP_000160435.1.24569 WP_000160435.1.24572 WP_000160435.1.2458 WP_000160435.1.24589 WP_000160435.1.24596 WP_000160435.1.24602 WP_000160435.1.24617 WP_000160435.1.24625 WP_000160435.1.24654 WP_000160435.1.24674 WP_000160435.1.24679 WP_000160435.1.24681 WP_000160435.1.24685 WP_000160435.1.24702 WP_000160435.1.24711 WP_000160435.1.24714 WP_000160435.1.24745 WP_000160435.1.24781 WP_000160435.1.2480 WP_000160435.1.24802 WP_000160435.1.24823 WP_000160435.1.24834 WP_000160435.1.24855 WP_000160435.1.24891 WP_000160435.1.24918 WP_000160435.1.24937 WP_000160435.1.24996 WP_000160435.1.25001 WP_000160435.1.25007 WP_000160435.1.25012 WP_000160435.1.2506 WP_000160435.1.25070 WP_000160435.1.25083 WP_000160435.1.25092 WP_000160435.1.25095 WP_000160435.1.25098 WP_000160435.1.25115 WP_000160435.1.25117 WP_000160435.1.25120 WP_000160435.1.25145 WP_000160435.1.25167 WP_000160435.1.25170 WP_000160435.1.25209 WP_000160435.1.25216 WP_000160435.1.25221 WP_000160435.1.25262 WP_000160435.1.25287 WP_000160435.1.25288 WP_000160435.1.25341 WP_000160435.1.25345 WP_000160435.1.25361 WP_000160435.1.25438 WP_000160435.1.2544 WP_000160435.1.25459 WP_000160435.1.25469 WP_000160435.1.25489 WP_000160435.1.25511 WP_000160435.1.2552 WP_000160435.1.25557 WP_000160435.1.25567 WP_000160435.1.25569 WP_000160435.1.25593 WP_000160435.1.25595 WP_000160435.1.25621 WP_000160435.1.25623 WP_000160435.1.25633 WP_000160435.1.25634 WP_000160435.1.25721 WP_000160435.1.25732 WP_000160435.1.25737 WP_000160435.1.25758 WP_000160435.1.25770 WP_000160435.1.25772 WP_000160435.1.25779 WP_000160435.1.2579 WP_000160435.1.25801 WP_000160435.1.25802 WP_000160435.1.25820 WP_000160435.1.25840 WP_000160435.1.25856 WP_000160435.1.25857 WP_000160435.1.25867 WP_000160435.1.25868 WP_000160435.1.25881 WP_000160435.1.25891 WP_000160435.1.2590 WP_000160435.1.25910 WP_000160435.1.2592 WP_000160435.1.25924 WP_000160435.1.25929 WP_000160435.1.2593 WP_000160435.1.25930 WP_000160435.1.25955 WP_000160435.1.26006 WP_000160435.1.26012 WP_000160435.1.26015 WP_000160435.1.26039 WP_000160435.1.26050 WP_000160435.1.26058 WP_000160435.1.2608 WP_000160435.1.26086 WP_000160435.1.26094 WP_000160435.1.26106 WP_000160435.1.26169 WP_000160435.1.262 WP_000160435.1.2621 WP_000160435.1.26225 WP_000160435.1.26226 WP_000160435.1.26255 WP_000160435.1.26266 WP_000160435.1.26271 WP_000160435.1.26276 WP_000160435.1.26283 WP_000160435.1.26290 WP_000160435.1.26293 WP_000160435.1.26298 WP_000160435.1.26306 WP_000160435.1.26307 WP_000160435.1.26314 WP_000160435.1.26318 WP_000160435.1.2633 WP_000160435.1.26340 WP_000160435.1.26345 WP_000160435.1.26346 WP_000160435.1.26354 WP_000160435.1.26359 WP_000160435.1.26364 WP_000160435.1.26370 WP_000160435.1.26399 WP_000160435.1.26404 WP_000160435.1.26424 WP_000160435.1.2643 WP_000160435.1.26431 WP_000160435.1.26481 WP_000160435.1.26506 WP_000160435.1.26533 WP_000160435.1.26555 WP_000160435.1.2656 WP_000160435.1.2658 WP_000160435.1.2661 WP_000160435.1.26626 WP_000160435.1.2664 WP_000160435.1.26662 WP_000160435.1.26663 WP_000160435.1.26664 WP_000160435.1.26677 WP_000160435.1.26692 WP_000160435.1.26713 WP_000160435.1.26726 WP_000160435.1.2673 WP_000160435.1.26733 WP_000160435.1.2674 WP_000160435.1.26751 WP_000160435.1.26771 WP_000160435.1.26772 WP_000160435.1.26773 WP_000160435.1.26778 WP_000160435.1.26790 WP_000160435.1.2680 WP_000160435.1.26804 WP_000160435.1.2684 WP_000160435.1.26840 WP_000160435.1.26864 WP_000160435.1.26865 WP_000160435.1.26884 WP_000160435.1.2689 WP_000160435.1.26903 WP_000160435.1.26905 WP_000160435.1.26927 WP_000160435.1.26938 WP_000160435.1.26944 WP_000160435.1.26947 WP_000160435.1.26958 WP_000160435.1.27013 WP_000160435.1.27042 WP_000160435.1.27053 WP_000160435.1.27083 WP_000160435.1.2710 WP_000160435.1.27147 WP_000160435.1.27154 WP_000160435.1.27160 WP_000160435.1.27166 WP_000160435.1.27170 WP_000160435.1.2718 WP_000160435.1.27182 WP_000160435.1.2719 WP_000160435.1.27199 WP_000160435.1.27207 WP_000160435.1.27226 WP_000160435.1.27237 WP_000160435.1.27246 WP_000160435.1.2725 WP_000160435.1.27262 WP_000160435.1.27293 WP_000160435.1.27294 WP_000160435.1.27303 WP_000160435.1.27311 WP_000160435.1.27323 WP_000160435.1.27333 WP_000160435.1.2734 WP_000160435.1.27345 WP_000160435.1.27379 WP_000160435.1.27384 WP_000160435.1.27387 WP_000160435.1.27413 WP_000160435.1.2744 WP_000160435.1.27447 WP_000160435.1.27448 WP_000160435.1.27455 WP_000160435.1.27456 WP_000160435.1.27457 WP_000160435.1.27468 WP_000160435.1.27489 WP_000160435.1.27516 WP_000160435.1.27529 WP_000160435.1.2753 WP_000160435.1.27539 WP_000160435.1.27551 WP_000160435.1.27562 WP_000160435.1.2759 WP_000160435.1.27590 WP_000160435.1.27605 WP_000160435.1.27608 WP_000160435.1.27614 WP_000160435.1.27615 WP_000160435.1.27621 WP_000160435.1.27628 WP_000160435.1.27640 WP_000160435.1.27646 WP_000160435.1.27654 WP_000160435.1.27670 WP_000160435.1.2768 WP_000160435.1.27689 WP_000160435.1.27717 WP_000160435.1.27720 WP_000160435.1.27739 WP_000160435.1.27744 WP_000160435.1.27748 WP_000160435.1.27765 WP_000160435.1.27787 WP_000160435.1.27793 WP_000160435.1.27817 WP_000160435.1.27830 WP_000160435.1.27834 WP_000160435.1.27854 WP_000160435.1.2795 WP_000160435.1.27950 WP_000160435.1.27953 WP_000160435.1.27972 WP_000160435.1.2800 WP_000160435.1.28007 WP_000160435.1.28016 WP_000160435.1.28025 WP_000160435.1.28063 WP_000160435.1.28071 WP_000160435.1.28074 WP_000160435.1.2808 WP_000160435.1.28081 WP_000160435.1.28088 WP_000160435.1.28091 WP_000160435.1.28105 WP_000160435.1.28107 WP_000160435.1.28117 WP_000160435.1.28138 WP_000160435.1.28147 WP_000160435.1.28158 WP_000160435.1.28173 WP_000160435.1.28191 WP_000160435.1.28207 WP_000160435.1.28213 WP_000160435.1.28226 WP_000160435.1.28230 WP_000160435.1.28253 WP_000160435.1.28257 WP_000160435.1.28274 WP_000160435.1.28315 WP_000160435.1.28319 WP_000160435.1.28334 WP_000160435.1.28336 WP_000160435.1.28337 WP_000160435.1.28347 WP_000160435.1.28360 WP_000160435.1.28376 WP_000160435.1.28381 WP_000160435.1.28392 WP_000160435.1.28394 WP_000160435.1.2840 WP_000160435.1.28400 WP_000160435.1.28426 WP_000160435.1.28430 WP_000160435.1.28477 WP_000160435.1.28490 WP_000160435.1.28498 WP_000160435.1.28501 WP_000160435.1.28502 WP_000160435.1.2852 WP_000160435.1.28526 WP_000160435.1.28527 WP_000160435.1.28532 WP_000160435.1.28578 WP_000160435.1.28580 WP_000160435.1.28605 WP_000160435.1.28629 WP_000160435.1.28636 WP_000160435.1.28650 WP_000160435.1.28652 WP_000160435.1.28672 WP_000160435.1.28690 WP_000160435.1.28710 WP_000160435.1.28720 WP_000160435.1.28725 WP_000160435.1.28763 WP_000160435.1.28784 WP_000160435.1.28785 WP_000160435.1.28825 WP_000160435.1.28833 WP_000160435.1.28848 WP_000160435.1.28866 WP_000160435.1.28871 WP_000160435.1.28874 WP_000160435.1.28887 WP_000160435.1.28909 WP_000160435.1.28915 WP_000160435.1.28925 WP_000160435.1.28933 WP_000160435.1.28934 WP_000160435.1.28960 WP_000160435.1.28970 WP_000160435.1.28981 WP_000160435.1.28987 WP_000160435.1.29014 WP_000160435.1.29052 WP_000160435.1.2906 WP_000160435.1.29060 WP_000160435.1.29090 WP_000160435.1.29091 WP_000160435.1.29107 WP_000160435.1.29110 WP_000160435.1.29112 WP_000160435.1.29155 WP_000160435.1.29166 WP_000160435.1.29187 WP_000160435.1.29188 WP_000160435.1.29207 WP_000160435.1.29226 WP_000160435.1.29242 WP_000160435.1.29272 WP_000160435.1.29276 WP_000160435.1.29282 WP_000160435.1.29285 WP_000160435.1.29312 WP_000160435.1.29315 WP_000160435.1.29329 WP_000160435.1.29340 WP_000160435.1.29366 WP_000160435.1.29368 WP_000160435.1.29372 WP_000160435.1.29373 WP_000160435.1.29375 WP_000160435.1.29381 WP_000160435.1.29395 WP_000160435.1.29420 WP_000160435.1.29433 WP_000160435.1.29445 WP_000160435.1.29453 WP_000160435.1.29468 WP_000160435.1.29479 WP_000160435.1.29483 WP_000160435.1.29484 WP_000160435.1.29511 WP_000160435.1.29522 WP_000160435.1.29541 WP_000160435.1.29553 WP_000160435.1.29554 WP_000160435.1.29557 WP_000160435.1.29561 WP_000160435.1.2957 WP_000160435.1.29571 WP_000160435.1.29596 WP_000160435.1.29644 WP_000160435.1.29676 WP_000160435.1.29692 WP_000160435.1.29709 WP_000160435.1.29710 WP_000160435.1.29716 WP_000160435.1.2972 WP_000160435.1.29736 WP_000160435.1.29744 WP_000160435.1.2975 WP_000160435.1.29758 WP_000160435.1.29788 WP_000160435.1.2981 WP_000160435.1.29826 WP_000160435.1.29862 WP_000160435.1.29885 WP_000160435.1.29902 WP_000160435.1.29905 WP_000160435.1.29918 WP_000160435.1.29956 WP_000160435.1.29963 WP_000160435.1.29981 WP_000160435.1.30012 WP_000160435.1.30023 WP_000160435.1.30033 WP_000160435.1.30047 WP_000160435.1.30051 WP_000160435.1.30057 WP_000160435.1.30089 WP_000160435.1.30095 WP_000160435.1.30100 WP_000160435.1.30115 WP_000160435.1.3012 WP_000160435.1.30152 WP_000160435.1.30154 WP_000160435.1.30159 WP_000160435.1.30169 WP_000160435.1.30176 WP_000160435.1.30186 WP_000160435.1.30190 WP_000160435.1.30197 WP_000160435.1.30203 WP_000160435.1.30204 WP_000160435.1.30209 WP_000160435.1.30230 WP_000160435.1.30249 WP_000160435.1.30268 WP_000160435.1.30274 WP_000160435.1.3029 WP_000160435.1.30302 WP_000160435.1.30307 WP_000160435.1.30328 WP_000160435.1.30333 WP_000160435.1.30350 WP_000160435.1.30364 WP_000160435.1.30367 WP_000160435.1.30376 WP_000160435.1.30381 WP_000160435.1.30392 WP_000160435.1.30418 WP_000160435.1.30422 WP_000160435.1.30458 WP_000160435.1.30477 WP_000160435.1.30482 WP_000160435.1.3050 WP_000160435.1.30508 WP_000160435.1.30530 WP_000160435.1.30531 WP_000160435.1.30560 WP_000160435.1.30600 WP_000160435.1.30622 WP_000160435.1.30623 WP_000160435.1.30645 WP_000160435.1.30646 WP_000160435.1.30666 WP_000160435.1.30668 WP_000160435.1.30702 WP_000160435.1.30720 WP_000160435.1.30726 WP_000160435.1.30758 WP_000160435.1.30763 WP_000160435.1.3077 WP_000160435.1.30779 WP_000160435.1.30845 WP_000160435.1.30847 WP_000160435.1.30854 WP_000160435.1.30862 WP_000160435.1.30863 WP_000160435.1.30874 WP_000160435.1.30878 WP_000160435.1.30889 WP_000160435.1.30911 WP_000160435.1.30916 WP_000160435.1.30962 WP_000160435.1.3097 WP_000160435.1.30970 WP_000160435.1.30971 WP_000160435.1.30998 WP_000160435.1.31005 WP_000160435.1.31022 WP_000160435.1.31037 WP_000160435.1.31039 WP_000160435.1.31048 WP_000160435.1.31068 WP_000160435.1.31091 WP_000160435.1.31120 WP_000160435.1.31123 WP_000160435.1.31124 WP_000160435.1.31176 WP_000160435.1.31194 WP_000160435.1.31202 WP_000160435.1.31204 WP_000160435.1.31206 WP_000160435.1.31212 WP_000160435.1.3123 WP_000160435.1.31232 WP_000160435.1.31294 WP_000160435.1.31315 WP_000160435.1.3132 WP_000160435.1.31337 WP_000160435.1.31339 WP_000160435.1.31355 WP_000160435.1.31376 WP_000160435.1.31377 WP_000160435.1.31402 WP_000160435.1.31424 WP_000160435.1.31426 WP_000160435.1.31436 WP_000160435.1.31437 WP_000160435.1.31442 WP_000160435.1.31462 WP_000160435.1.31468 WP_000160435.1.31478 WP_000160435.1.31479 WP_000160435.1.31484 WP_000160435.1.315 WP_000160435.1.31505 WP_000160435.1.31529 WP_000160435.1.31531 WP_000160435.1.31539 WP_000160435.1.31567 WP_000160435.1.31611 WP_000160435.1.31621 WP_000160435.1.31638 WP_000160435.1.31642 WP_000160435.1.31647 WP_000160435.1.31653 WP_000160435.1.31667 WP_000160435.1.31686 WP_000160435.1.31701 WP_000160435.1.31753 WP_000160435.1.31787 WP_000160435.1.31791 WP_000160435.1.31797 WP_000160435.1.31806 WP_000160435.1.31816 WP_000160435.1.31817 WP_000160435.1.31827 WP_000160435.1.31828 WP_000160435.1.31842 WP_000160435.1.31892 WP_000160435.1.31897 WP_000160435.1.31925 WP_000160435.1.31931 WP_000160435.1.31943 WP_000160435.1.31949 WP_000160435.1.31990 WP_000160435.1.31994 WP_000160435.1.31997 WP_000160435.1.32003 WP_000160435.1.32005 WP_000160435.1.32029 WP_000160435.1.32040 WP_000160435.1.32059 WP_000160435.1.32067 WP_000160435.1.32095 WP_000160435.1.32118 WP_000160435.1.32122 WP_000160435.1.32125 WP_000160435.1.32130 WP_000160435.1.32160 WP_000160435.1.32167 WP_000160435.1.3219 WP_000160435.1.32207 WP_000160435.1.32215 WP_000160435.1.32217 WP_000160435.1.32244 WP_000160435.1.32248 WP_000160435.1.32270 WP_000160435.1.32281 WP_000160435.1.32295 WP_000160435.1.32301 WP_000160435.1.32325 WP_000160435.1.32338 WP_000160435.1.32339 WP_000160435.1.32340 WP_000160435.1.32348 WP_000160435.1.32365 WP_000160435.1.32384 WP_000160435.1.32405 WP_000160435.1.3242 WP_000160435.1.3244 WP_000160435.1.32464 WP_000160435.1.32474 WP_000160435.1.32481 WP_000160435.1.32483 WP_000160435.1.32497 WP_000160435.1.32514 WP_000160435.1.32517 WP_000160435.1.32534 WP_000160435.1.32546 WP_000160435.1.32565 WP_000160435.1.32588 WP_000160435.1.32607 WP_000160435.1.32634 WP_000160435.1.32636 WP_000160435.1.32645 WP_000160435.1.32671 WP_000160435.1.32739 WP_000160435.1.32746 WP_000160435.1.32754 WP_000160435.1.32764 WP_000160435.1.32770 WP_000160435.1.32795 WP_000160435.1.328 WP_000160435.1.32800 WP_000160435.1.32839 WP_000160435.1.32921 WP_000160435.1.32925 WP_000160435.1.32928 WP_000160435.1.3293 WP_000160435.1.32939 WP_000160435.1.32954 WP_000160435.1.32965 WP_000160435.1.32980 WP_000160435.1.32987 WP_000160435.1.3299 WP_000160435.1.3301 WP_000160435.1.33038 WP_000160435.1.33048 WP_000160435.1.3306 WP_000160435.1.33108 WP_000160435.1.33110 WP_000160435.1.33123 WP_000160435.1.33138 WP_000160435.1.33147 WP_000160435.1.3316 WP_000160435.1.33161 WP_000160435.1.33172 WP_000160435.1.33199 WP_000160435.1.33212 WP_000160435.1.33213 WP_000160435.1.33250 WP_000160435.1.33252 WP_000160435.1.33255 WP_000160435.1.33266 WP_000160435.1.33292 WP_000160435.1.33296 WP_000160435.1.33307 WP_000160435.1.33335 WP_000160435.1.3335 WP_000160435.1.33350 WP_000160435.1.33357 WP_000160435.1.33368 WP_000160435.1.33372 WP_000160435.1.3338 WP_000160435.1.33388 WP_000160435.1.33394 WP_000160435.1.3341 WP_000160435.1.33416 WP_000160435.1.3342 WP_000160435.1.33426 WP_000160435.1.33432 WP_000160435.1.3345 WP_000160435.1.33463 WP_000160435.1.33468 WP_000160435.1.3347 WP_000160435.1.33483 WP_000160435.1.33484 WP_000160435.1.33507 WP_000160435.1.33516 WP_000160435.1.33518 WP_000160435.1.33520 WP_000160435.1.33540 WP_000160435.1.3357 WP_000160435.1.33575 WP_000160435.1.33594 WP_000160435.1.33610 WP_000160435.1.33626 WP_000160435.1.33627 WP_000160435.1.3363 WP_000160435.1.33640 WP_000160435.1.33650 WP_000160435.1.33654 WP_000160435.1.33692 WP_000160435.1.33695 WP_000160435.1.33718 WP_000160435.1.33720 WP_000160435.1.33724 WP_000160435.1.33735 WP_000160435.1.33737 WP_000160435.1.33743 WP_000160435.1.33765 WP_000160435.1.33766 WP_000160435.1.33769 WP_000160435.1.33778 WP_000160435.1.33792 WP_000160435.1.33804 WP_000160435.1.33813 WP_000160435.1.33816 WP_000160435.1.33855 WP_000160435.1.33899 WP_000160435.1.33915 WP_000160435.1.33963 WP_000160435.1.33966 WP_000160435.1.33968 WP_000160435.1.33971 WP_000160435.1.33983 WP_000160435.1.33994 WP_000160435.1.34026 WP_000160435.1.34030 WP_000160435.1.34051 WP_000160435.1.34062 WP_000160435.1.34069 WP_000160435.1.34079 WP_000160435.1.34080 WP_000160435.1.34089 WP_000160435.1.34100 WP_000160435.1.34105 WP_000160435.1.34112 WP_000160435.1.34128 WP_000160435.1.34132 WP_000160435.1.34168 WP_000160435.1.34172 WP_000160435.1.3418 WP_000160435.1.34182 WP_000160435.1.34194 WP_000160435.1.34209 WP_000160435.1.3422 WP_000160435.1.34223 WP_000160435.1.34231 WP_000160435.1.34244 WP_000160435.1.34249 WP_000160435.1.34250 WP_000160435.1.34251 WP_000160435.1.34280 WP_000160435.1.34285 WP_000160435.1.34334 WP_000160435.1.34361 WP_000160435.1.34381 WP_000160435.1.34403 WP_000160435.1.34410 WP_000160435.1.3442 WP_000160435.1.34436 WP_000160435.1.3448 WP_000160435.1.34482 WP_000160435.1.34492 WP_000160435.1.34502 WP_000160435.1.34510 WP_000160435.1.34512 WP_000160435.1.34526 WP_000160435.1.34531 WP_000160435.1.34569 WP_000160435.1.3461 WP_000160435.1.34620 WP_000160435.1.34626 WP_000160435.1.34666 WP_000160435.1.34677 WP_000160435.1.34716 WP_000160435.1.34723 WP_000160435.1.34737 WP_000160435.1.3474 WP_000160435.1.34741 WP_000160435.1.34767 WP_000160435.1.34818 WP_000160435.1.34847 WP_000160435.1.34865 WP_000160435.1.34890 WP_000160435.1.34918 WP_000160435.1.34967 WP_000160435.1.34998 WP_000160435.1.35014 WP_000160435.1.35029 WP_000160435.1.35031 WP_000160435.1.35032 WP_000160435.1.35059 WP_000160435.1.35062 WP_000160435.1.35089 WP_000160435.1.35097 WP_000160435.1.35106 WP_000160435.1.35108 WP_000160435.1.35110 WP_000160435.1.35121 WP_000160435.1.35177 WP_000160435.1.35183 WP_000160435.1.35189 WP_000160435.1.35222 WP_000160435.1.35233 WP_000160435.1.35243 WP_000160435.1.35257 WP_000160435.1.35276 WP_000160435.1.35285 WP_000160435.1.35289 WP_000160435.1.35297 WP_000160435.1.35307 WP_000160435.1.35314 WP_000160435.1.35334 WP_000160435.1.35340 WP_000160435.1.35342 WP_000160435.1.35352 WP_000160435.1.35391 WP_000160435.1.35413 WP_000160435.1.35415 WP_000160435.1.3542 WP_000160435.1.35433 WP_000160435.1.35435 WP_000160435.1.3547 WP_000160435.1.35490 WP_000160435.1.35497 WP_000160435.1.35498 WP_000160435.1.35508 WP_000160435.1.35517 WP_000160435.1.35519 WP_000160435.1.3552 WP_000160435.1.35525 WP_000160435.1.35549 WP_000160435.1.35580 WP_000160435.1.35615 WP_000160435.1.35623 WP_000160435.1.35642 WP_000160435.1.35643 WP_000160435.1.35659 WP_000160435.1.35661 WP_000160435.1.35673 WP_000160435.1.35686 WP_000160435.1.3569 WP_000160435.1.35696 WP_000160435.1.35746 WP_000160435.1.35774 WP_000160435.1.35784 WP_000160435.1.3579 WP_000160435.1.35794 WP_000160435.1.35799 WP_000160435.1.35801 WP_000160435.1.35826 WP_000160435.1.35837 WP_000160435.1.35888 WP_000160435.1.35890 WP_000160435.1.35900 WP_000160435.1.35903 WP_000160435.1.35928 WP_000160435.1.35950 WP_000160435.1.36004 WP_000160435.1.36021 WP_000160435.1.36082 WP_000160435.1.36093 WP_000160435.1.36102 WP_000160435.1.36117 WP_000160435.1.36119 WP_000160435.1.36141 WP_000160435.1.3617 WP_000160435.1.36175 WP_000160435.1.36176 WP_000160435.1.36179 WP_000160435.1.36187 WP_000160435.1.36188 WP_000160435.1.36193 WP_000160435.1.36208 WP_000160435.1.36211 WP_000160435.1.36220 WP_000160435.1.36223 WP_000160435.1.3623 WP_000160435.1.36231 WP_000160435.1.36249 WP_000160435.1.36250 WP_000160435.1.36264 WP_000160435.1.36278 WP_000160435.1.36282 WP_000160435.1.36283 WP_000160435.1.36302 WP_000160435.1.36307 WP_000160435.1.36325 WP_000160435.1.36344 WP_000160435.1.36389 WP_000160435.1.36430 WP_000160435.1.36434 WP_000160435.1.36439 WP_000160435.1.36522 WP_000160435.1.36532 WP_000160435.1.3655 WP_000160435.1.36551 WP_000160435.1.36570 WP_000160435.1.36580 WP_000160435.1.36600 WP_000160435.1.36604 WP_000160435.1.36615 WP_000160435.1.36640 WP_000160435.1.36646 WP_000160435.1.3666 WP_000160435.1.36689 WP_000160435.1.36697 WP_000160435.1.36704 WP_000160435.1.36729 WP_000160435.1.36745 WP_000160435.1.3675 WP_000160435.1.36770 WP_000160435.1.36773 WP_000160435.1.36783 WP_000160435.1.36793 WP_000160435.1.36796 WP_000160435.1.36809 WP_000160435.1.36814 WP_000160435.1.36822 WP_000160435.1.36823 WP_000160435.1.36847 WP_000160435.1.3685 WP_000160435.1.36858 WP_000160435.1.3687 WP_000160435.1.36884 WP_000160435.1.36888 WP_000160435.1.36903 WP_000160435.1.36911 WP_000160435.1.36932 WP_000160435.1.36952 WP_000160435.1.36955 WP_000160435.1.36979 WP_000160435.1.36980 WP_000160435.1.36983 WP_000160435.1.36997 WP_000160435.1.37002 WP_000160435.1.37016 WP_000160435.1.3703 WP_000160435.1.37044 WP_000160435.1.37053 WP_000160435.1.37055 WP_000160435.1.37075 WP_000160435.1.37080 WP_000160435.1.3709 WP_000160435.1.37120 WP_000160435.1.37121 WP_000160435.1.37130 WP_000160435.1.37132 WP_000160435.1.37134 WP_000160435.1.37135 WP_000160435.1.37145 WP_000160435.1.37159 WP_000160435.1.3722 WP_000160435.1.37220 WP_000160435.1.37240 WP_000160435.1.37304 WP_000160435.1.37335 WP_000160435.1.37341 WP_000160435.1.37354 WP_000160435.1.37378 WP_000160435.1.37398 WP_000160435.1.37408 WP_000160435.1.37411 WP_000160435.1.37424 WP_000160435.1.37435 WP_000160435.1.37467 WP_000160435.1.37503 WP_000160435.1.37525 WP_000160435.1.37536 WP_000160435.1.37546 WP_000160435.1.37563 WP_000160435.1.37578 WP_000160435.1.37583 WP_000160435.1.37602 WP_000160435.1.37605 WP_000160435.1.37606 WP_000160435.1.37621 WP_000160435.1.37624 WP_000160435.1.37636 WP_000160435.1.37644 WP_000160435.1.37652 WP_000160435.1.37669 WP_000160435.1.37679 WP_000160435.1.3774 WP_000160435.1.37749 WP_000160435.1.3776 WP_000160435.1.37764 WP_000160435.1.37771 WP_000160435.1.37781 WP_000160435.1.37788 WP_000160435.1.37795 WP_000160435.1.37815 WP_000160435.1.37828 WP_000160435.1.3784 WP_000160435.1.37851 WP_000160435.1.37906 WP_000160435.1.37907 WP_000160435.1.37929 WP_000160435.1.37953 WP_000160435.1.37987 WP_000160435.1.38007 WP_000160435.1.38030 WP_000160435.1.38038 WP_000160435.1.38057 WP_000160435.1.38070 WP_000160435.1.38082 WP_000160435.1.3809 WP_000160435.1.38100 WP_000160435.1.38111 WP_000160435.1.38128 WP_000160435.1.38136 WP_000160435.1.38148 WP_000160435.1.38160 WP_000160435.1.38177 WP_000160435.1.3820 WP_000160435.1.38212 WP_000160435.1.38222 WP_000160435.1.38229 WP_000160435.1.38230 WP_000160435.1.38232 WP_000160435.1.3827 WP_000160435.1.38276 WP_000160435.1.38282 WP_000160435.1.38304 WP_000160435.1.38309 WP_000160435.1.38311 WP_000160435.1.38316 WP_000160435.1.38330 WP_000160435.1.38336 WP_000160435.1.38346 WP_000160435.1.38383 WP_000160435.1.38390 WP_000160435.1.3842 WP_000160435.1.38422 WP_000160435.1.38437 WP_000160435.1.38453 WP_000160435.1.38489 WP_000160435.1.38493 WP_000160435.1.3850 WP_000160435.1.38516 WP_000160435.1.3852 WP_000160435.1.38522 WP_000160435.1.38546 WP_000160435.1.38551 WP_000160435.1.38555 WP_000160435.1.38600 WP_000160435.1.38607 WP_000160435.1.38612 WP_000160435.1.38637 WP_000160435.1.38658 WP_000160435.1.3867 WP_000160435.1.38674 WP_000160435.1.38688 WP_000160435.1.38721 WP_000160435.1.3875 WP_000160435.1.38760 WP_000160435.1.38788 WP_000160435.1.38823 WP_000160435.1.38836 WP_000160435.1.38841 WP_000160435.1.38858 WP_000160435.1.38862 WP_000160435.1.38875 WP_000160435.1.38885 WP_000160435.1.38890 WP_000160435.1.38927 WP_000160435.1.38931 WP_000160435.1.3894 WP_000160435.1.38940 WP_000160435.1.38941 WP_000160435.1.38960 WP_000160435.1.38972 WP_000160435.1.38973 WP_000160435.1.38989 WP_000160435.1.390 WP_000160435.1.39012 WP_000160435.1.39014 WP_000160435.1.39017 WP_000160435.1.39020 WP_000160435.1.39026 WP_000160435.1.39043 WP_000160435.1.39053 WP_000160435.1.3906 WP_000160435.1.39089 WP_000160435.1.391 WP_000160435.1.39108 WP_000160435.1.39117 WP_000160435.1.39166 WP_000160435.1.39173 WP_000160435.1.39203 WP_000160435.1.39206 WP_000160435.1.39217 WP_000160435.1.3926 WP_000160435.1.39272 WP_000160435.1.39281 WP_000160435.1.39290 WP_000160435.1.39324 WP_000160435.1.39330 WP_000160435.1.39332 WP_000160435.1.39333 WP_000160435.1.39361 WP_000160435.1.39368 WP_000160435.1.39384 WP_000160435.1.39397 WP_000160435.1.39406 WP_000160435.1.39432 WP_000160435.1.39451 WP_000160435.1.39486 WP_000160435.1.39494 WP_000160435.1.39506 WP_000160435.1.39527 WP_000160435.1.39542 WP_000160435.1.39550 WP_000160435.1.39625 WP_000160435.1.39642 WP_000160435.1.39645 WP_000160435.1.39662 WP_000160435.1.39670 WP_000160435.1.39671 WP_000160435.1.39682 WP_000160435.1.39687 WP_000160435.1.39689 WP_000160435.1.39693 WP_000160435.1.39697 WP_000160435.1.39711 WP_000160435.1.39738 WP_000160435.1.39767 WP_000160435.1.39773 WP_000160435.1.39789 WP_000160435.1.39812 WP_000160435.1.39832 WP_000160435.1.39834 WP_000160435.1.39838 WP_000160435.1.39839 WP_000160435.1.39856 WP_000160435.1.39857 WP_000160435.1.39869 WP_000160435.1.39875 WP_000160435.1.39880 WP_000160435.1.39943 WP_000160435.1.39995 WP_000160435.1.40014 WP_000160435.1.40043 WP_000160435.1.40053 WP_000160435.1.4006 WP_000160435.1.40076 WP_000160435.1.40082 WP_000160435.1.40085 WP_000160435.1.40099 WP_000160435.1.4010 WP_000160435.1.4012 WP_000160435.1.40120 WP_000160435.1.40130 WP_000160435.1.40149 WP_000160435.1.4015 WP_000160435.1.40164 WP_000160435.1.40173 WP_000160435.1.4019 WP_000160435.1.40220 WP_000160435.1.40247 WP_000160435.1.4025 WP_000160435.1.40299 WP_000160435.1.40316 WP_000160435.1.40318 WP_000160435.1.40320 WP_000160435.1.40322 WP_000160435.1.40329 WP_000160435.1.40330 WP_000160435.1.40342 WP_000160435.1.40368 WP_000160435.1.40369 WP_000160435.1.40406 WP_000160435.1.40409 WP_000160435.1.40428 WP_000160435.1.40435 WP_000160435.1.4045 WP_000160435.1.40454 WP_000160435.1.40463 WP_000160435.1.40472 WP_000160435.1.40474 WP_000160435.1.40481 WP_000160435.1.40483 WP_000160435.1.40500 WP_000160435.1.40505 WP_000160435.1.40531 WP_000160435.1.40532 WP_000160435.1.4056 WP_000160435.1.4057 WP_000160435.1.40579 WP_000160435.1.40588 WP_000160435.1.40613 WP_000160435.1.40620 WP_000160435.1.40644 WP_000160435.1.40655 WP_000160435.1.40658 WP_000160435.1.40659 WP_000160435.1.40670 WP_000160435.1.40700 WP_000160435.1.40719 WP_000160435.1.40729 WP_000160435.1.40760 WP_000160435.1.4078 WP_000160435.1.40780 WP_000160435.1.40794 WP_000160435.1.40797 WP_000160435.1.40814 WP_000160435.1.40816 WP_000160435.1.40939 WP_000160435.1.40954 WP_000160435.1.40997 WP_000160435.1.41002 WP_000160435.1.41038 WP_000160435.1.4105 WP_000160435.1.41064 WP_000160435.1.41066 WP_000160435.1.41084 WP_000160435.1.41094 WP_000160435.1.41098 WP_000160435.1.41109 WP_000160435.1.41119 WP_000160435.1.41129 WP_000160435.1.4115 WP_000160435.1.41178 WP_000160435.1.412 WP_000160435.1.41208 WP_000160435.1.41238 WP_000160435.1.41241 WP_000160435.1.41245 WP_000160435.1.41255 WP_000160435.1.41288 WP_000160435.1.41289 WP_000160435.1.4129 WP_000160435.1.41314 WP_000160435.1.41350 WP_000160435.1.41374 WP_000160435.1.4138 WP_000160435.1.41386 WP_000160435.1.41389 WP_000160435.1.41411 WP_000160435.1.41426 WP_000160435.1.41432 WP_000160435.1.41433 WP_000160435.1.41444 WP_000160435.1.41448 WP_000160435.1.41458 WP_000160435.1.41461 WP_000160435.1.41499 WP_000160435.1.41511 WP_000160435.1.41555 WP_000160435.1.41558 WP_000160435.1.41567 WP_000160435.1.41581 WP_000160435.1.41582 WP_000160435.1.41587 WP_000160435.1.41597 WP_000160435.1.41598 WP_000160435.1.41599 WP_000160435.1.4160 WP_000160435.1.41612 WP_000160435.1.4162 WP_000160435.1.41620 WP_000160435.1.41623 WP_000160435.1.41647 WP_000160435.1.41674 WP_000160435.1.41681 WP_000160435.1.4169 WP_000160435.1.41726 WP_000160435.1.41743 WP_000160435.1.41755 WP_000160435.1.41770 WP_000160435.1.41796 WP_000160435.1.4182 WP_000160435.1.41839 WP_000160435.1.41863 WP_000160435.1.4188 WP_000160435.1.41898 WP_000160435.1.41906 WP_000160435.1.41935 WP_000160435.1.41943 WP_000160435.1.41983 WP_000160435.1.41989 WP_000160435.1.420 WP_000160435.1.42003 WP_000160435.1.42005 WP_000160435.1.42015 WP_000160435.1.42017 WP_000160435.1.4202 WP_000160435.1.42028 WP_000160435.1.42056 WP_000160435.1.42064 WP_000160435.1.42072 WP_000160435.1.42085 WP_000160435.1.42087 WP_000160435.1.42125 WP_000160435.1.42137 WP_000160435.1.42169 WP_000160435.1.42177 WP_000160435.1.42178 WP_000160435.1.42198 WP_000160435.1.42230 WP_000160435.1.42241 WP_000160435.1.4225 WP_000160435.1.42269 WP_000160435.1.42286 WP_000160435.1.42298 WP_000160435.1.42305 WP_000160435.1.4231 WP_000160435.1.42325 WP_000160435.1.42336 WP_000160435.1.42344 WP_000160435.1.42355 WP_000160435.1.42403 WP_000160435.1.42436 WP_000160435.1.42438 WP_000160435.1.42455 WP_000160435.1.42459 WP_000160435.1.42481 WP_000160435.1.42503 WP_000160435.1.42510 WP_000160435.1.42517 WP_000160435.1.42593 WP_000160435.1.42598 WP_000160435.1.426 WP_000160435.1.4260 WP_000160435.1.42607 WP_000160435.1.42640 WP_000160435.1.42652 WP_000160435.1.42667 WP_000160435.1.42668 WP_000160435.1.42674 WP_000160435.1.42679 WP_000160435.1.42681 WP_000160435.1.42706 WP_000160435.1.42733 WP_000160435.1.42737 WP_000160435.1.42759 WP_000160435.1.42764 WP_000160435.1.42786 WP_000160435.1.42788 WP_000160435.1.42798 WP_000160435.1.42802 WP_000160435.1.42816 WP_000160435.1.42837 WP_000160435.1.42883 WP_000160435.1.42893 WP_000160435.1.42907 WP_000160435.1.42925 WP_000160435.1.4293 WP_000160435.1.42959 WP_000160435.1.42982 WP_000160435.1.42984 WP_000160435.1.42985 WP_000160435.1.4299 WP_000160435.1.42990 WP_000160435.1.4300 WP_000160435.1.43014 WP_000160435.1.43023 WP_000160435.1.43033 WP_000160435.1.43047 WP_000160435.1.43061 WP_000160435.1.43072 WP_000160435.1.43095 WP_000160435.1.43110 WP_000160435.1.43122 WP_000160435.1.43125 WP_000160435.1.43131 WP_000160435.1.43134 WP_000160435.1.43139 WP_000160435.1.43143 WP_000160435.1.43147 WP_000160435.1.43159 WP_000160435.1.43165 WP_000160435.1.43168 WP_000160435.1.43179 WP_000160435.1.43202 WP_000160435.1.43204 WP_000160435.1.43225 WP_000160435.1.43232 WP_000160435.1.43248 WP_000160435.1.4325 WP_000160435.1.43252 WP_000160435.1.43263 WP_000160435.1.4327 WP_000160435.1.43274 WP_000160435.1.43279 WP_000160435.1.43323 WP_000160435.1.43325 WP_000160435.1.43328 WP_000160435.1.43331 WP_000160435.1.43341 WP_000160435.1.43349 WP_000160435.1.43360 WP_000160435.1.43366 WP_000160435.1.43369 WP_000160435.1.4337 WP_000160435.1.43375 WP_000160435.1.43383 WP_000160435.1.43405 WP_000160435.1.43406 WP_000160435.1.4341 WP_000160435.1.43410 WP_000160435.1.43414 WP_000160435.1.43446 WP_000160435.1.43460 WP_000160435.1.4347 WP_000160435.1.43512 WP_000160435.1.43530 WP_000160435.1.43550 WP_000160435.1.43560 WP_000160435.1.43573 WP_000160435.1.43594 WP_000160435.1.43600 WP_000160435.1.43617 WP_000160435.1.43618 WP_000160435.1.43627 WP_000160435.1.43659 WP_000160435.1.43665 WP_000160435.1.43670 WP_000160435.1.43683 WP_000160435.1.43693 WP_000160435.1.4370 WP_000160435.1.43702 WP_000160435.1.43703 WP_000160435.1.4372 WP_000160435.1.43731 WP_000160435.1.4374 WP_000160435.1.43752 WP_000160435.1.43784 WP_000160435.1.43788 WP_000160435.1.4380 WP_000160435.1.43800 WP_000160435.1.43819 WP_000160435.1.43822 WP_000160435.1.43827 WP_000160435.1.4385 WP_000160435.1.43851 WP_000160435.1.4386 WP_000160435.1.43904 WP_000160435.1.43915 WP_000160435.1.43924 WP_000160435.1.43964 WP_000160435.1.43984 WP_000160435.1.43995 WP_000160435.1.44072 WP_000160435.1.44074 WP_000160435.1.44095 WP_000160435.1.44119 WP_000160435.1.44153 WP_000160435.1.44177 WP_000160435.1.44178 WP_000160435.1.44181 WP_000160435.1.44195 WP_000160435.1.44265 WP_000160435.1.44302 WP_000160435.1.44312 WP_000160435.1.44344 WP_000160435.1.44382 WP_000160435.1.44388 WP_000160435.1.44396 WP_000160435.1.44405 WP_000160435.1.44420 WP_000160435.1.44432 WP_000160435.1.44455 WP_000160435.1.44493 WP_000160435.1.44515 WP_000160435.1.44517 WP_000160435.1.44520 WP_000160435.1.44544 WP_000160435.1.44547 WP_000160435.1.44579 WP_000160435.1.44586 WP_000160435.1.44588 WP_000160435.1.44605 WP_000160435.1.44623 WP_000160435.1.44631 WP_000160435.1.44646 WP_000160435.1.44655 WP_000160435.1.44667 WP_000160435.1.44672 WP_000160435.1.44674 WP_000160435.1.447 WP_000160435.1.44714 WP_000160435.1.44715 WP_000160435.1.44732 WP_000160435.1.44755 WP_000160435.1.44768 WP_000160435.1.44780 WP_000160435.1.44785 WP_000160435.1.44788 WP_000160435.1.44796 WP_000160435.1.44802 WP_000160435.1.44853 WP_000160435.1.44856 WP_000160435.1.44868 WP_000160435.1.44876 WP_000160435.1.44881 WP_000160435.1.44882 WP_000160435.1.44891 WP_000160435.1.44892 WP_000160435.1.44899 WP_000160435.1.44903 WP_000160435.1.44914 WP_000160435.1.44932 WP_000160435.1.44940 WP_000160435.1.44955 WP_000160435.1.44969 WP_000160435.1.44993 WP_000160435.1.45015 WP_000160435.1.45033 WP_000160435.1.45035 WP_000160435.1.45042 WP_000160435.1.45050 WP_000160435.1.45080 WP_000160435.1.45091 WP_000160435.1.45094 WP_000160435.1.45099 WP_000160435.1.45101 WP_000160435.1.45111 WP_000160435.1.4513 WP_000160435.1.45131 WP_000160435.1.45132 WP_000160435.1.45133 WP_000160435.1.45140 WP_000160435.1.45157 WP_000160435.1.45162 WP_000160435.1.45170 WP_000160435.1.45188 WP_000160435.1.45189 WP_000160435.1.452 WP_000160435.1.45218 WP_000160435.1.45223 WP_000160435.1.45242 WP_000160435.1.45267 WP_000160435.1.4527 WP_000160435.1.45272 WP_000160435.1.45281 WP_000160435.1.45290 WP_000160435.1.45297 WP_000160435.1.453 WP_000160435.1.45321 WP_000160435.1.45332 WP_000160435.1.45364 WP_000160435.1.45419 WP_000160435.1.45431 WP_000160435.1.45439 WP_000160435.1.4545 WP_000160435.1.45450 WP_000160435.1.45456 WP_000160435.1.4546 WP_000160435.1.45472 WP_000160435.1.45492 WP_000160435.1.4550 WP_000160435.1.45507 WP_000160435.1.45542 WP_000160435.1.45555 WP_000160435.1.45560 WP_000160435.1.45574 WP_000160435.1.45577 WP_000160435.1.45586 WP_000160435.1.45610 WP_000160435.1.45620 WP_000160435.1.45640 WP_000160435.1.45645 WP_000160435.1.45670 WP_000160435.1.45698 WP_000160435.1.45703 WP_000160435.1.45705 WP_000160435.1.45713 WP_000160435.1.45730 WP_000160435.1.45734 WP_000160435.1.45747 WP_000160435.1.45763 WP_000160435.1.45768 WP_000160435.1.4577 WP_000160435.1.45771 WP_000160435.1.45773 WP_000160435.1.45780 WP_000160435.1.4580 WP_000160435.1.4582 WP_000160435.1.45822 WP_000160435.1.45833 WP_000160435.1.4584 WP_000160435.1.45852 WP_000160435.1.45859 WP_000160435.1.45862 WP_000160435.1.45870 WP_000160435.1.45874 WP_000160435.1.45875 WP_000160435.1.45881 WP_000160435.1.45888 WP_000160435.1.45897 WP_000160435.1.459 WP_000160435.1.45954 WP_000160435.1.4597 WP_000160435.1.45972 WP_000160435.1.45977 WP_000160435.1.45979 WP_000160435.1.4598 WP_000160435.1.46003 WP_000160435.1.46005 WP_000160435.1.46021 WP_000160435.1.46037 WP_000160435.1.46050 WP_000160435.1.46055 WP_000160435.1.46062 WP_000160435.1.46071 WP_000160435.1.46078 WP_000160435.1.46082 WP_000160435.1.46087 WP_000160435.1.46106 WP_000160435.1.46136 WP_000160435.1.46168 WP_000160435.1.46171 WP_000160435.1.46172 WP_000160435.1.46185 WP_000160435.1.46195 WP_000160435.1.46208 WP_000160435.1.46212 WP_000160435.1.46222 WP_000160435.1.46228 WP_000160435.1.46248 WP_000160435.1.46259 WP_000160435.1.46276 WP_000160435.1.46289 WP_000160435.1.46320 WP_000160435.1.46330 WP_000160435.1.46333 WP_000160435.1.46334 WP_000160435.1.46339 WP_000160435.1.46353 WP_000160435.1.46362 WP_000160435.1.46368 WP_000160435.1.46380 WP_000160435.1.46389 WP_000160435.1.46401 WP_000160435.1.46418 WP_000160435.1.46422 WP_000160435.1.46457 WP_000160435.1.46465 WP_000160435.1.46514 WP_000160435.1.46528 WP_000160435.1.46529 WP_000160435.1.46534 WP_000160435.1.46543 WP_000160435.1.46608 WP_000160435.1.4662 WP_000160435.1.46648 WP_000160435.1.46660 WP_000160435.1.46664 WP_000160435.1.46670 WP_000160435.1.46676 WP_000160435.1.46688 WP_000160435.1.46692 WP_000160435.1.46702 WP_000160435.1.46703 WP_000160435.1.46720 WP_000160435.1.46736 WP_000160435.1.46752 WP_000160435.1.46765 WP_000160435.1.46767 WP_000160435.1.46770 WP_000160435.1.46772 WP_000160435.1.4680 WP_000160435.1.46815 WP_000160435.1.46823 WP_000160435.1.46837 WP_000160435.1.46852 WP_000160435.1.46875 WP_000160435.1.46881 WP_000160435.1.46906 WP_000160435.1.46908 WP_000160435.1.46911 WP_000160435.1.46914 WP_000160435.1.46925 WP_000160435.1.46929 WP_000160435.1.46937 WP_000160435.1.4694 WP_000160435.1.46947 WP_000160435.1.4696 WP_000160435.1.46964 WP_000160435.1.46983 WP_000160435.1.46995 WP_000160435.1.47002 WP_000160435.1.47051 WP_000160435.1.47065 WP_000160435.1.47090 WP_000160435.1.47105 WP_000160435.1.47107 WP_000160435.1.47111 WP_000160435.1.47128 WP_000160435.1.47153 WP_000160435.1.47159 WP_000160435.1.4716 WP_000160435.1.47163 WP_000160435.1.47187 WP_000160435.1.47193 WP_000160435.1.47205 WP_000160435.1.47211 WP_000160435.1.47216 WP_000160435.1.47218 WP_000160435.1.47250 WP_000160435.1.47258 WP_000160435.1.47269 WP_000160435.1.47279 WP_000160435.1.4728 WP_000160435.1.47282 WP_000160435.1.47290 WP_000160435.1.47294 WP_000160435.1.47306 WP_000160435.1.47317 WP_000160435.1.47328 WP_000160435.1.47331 WP_000160435.1.47334 WP_000160435.1.47353 WP_000160435.1.47381 WP_000160435.1.47383 WP_000160435.1.47399 WP_000160435.1.47405 WP_000160435.1.47406 WP_000160435.1.47408 WP_000160435.1.47422 WP_000160435.1.47426 WP_000160435.1.47432 WP_000160435.1.47439 WP_000160435.1.47450 WP_000160435.1.47459 WP_000160435.1.47493 WP_000160435.1.4752 WP_000160435.1.47522 WP_000160435.1.47541 WP_000160435.1.47560 WP_000160435.1.47561 WP_000160435.1.47570 WP_000160435.1.47577 WP_000160435.1.47617 WP_000160435.1.47618 WP_000160435.1.47629 WP_000160435.1.47669 WP_000160435.1.4767 WP_000160435.1.477 WP_000160435.1.47702 WP_000160435.1.47733 WP_000160435.1.47747 WP_000160435.1.47763 WP_000160435.1.47782 WP_000160435.1.47792 WP_000160435.1.47821 WP_000160435.1.47835 WP_000160435.1.47836 WP_000160435.1.47851 WP_000160435.1.47859 WP_000160435.1.47864 WP_000160435.1.47872 WP_000160435.1.47873 WP_000160435.1.47888 WP_000160435.1.47901 WP_000160435.1.47904 WP_000160435.1.47908 WP_000160435.1.4792 WP_000160435.1.47951 WP_000160435.1.47980 WP_000160435.1.47996 WP_000160435.1.48009 WP_000160435.1.48011 WP_000160435.1.48030 WP_000160435.1.48046 WP_000160435.1.48047 WP_000160435.1.4805 WP_000160435.1.48057 WP_000160435.1.48064 WP_000160435.1.48067 WP_000160435.1.48142 WP_000160435.1.48149 WP_000160435.1.4815 WP_000160435.1.48154 WP_000160435.1.48156 WP_000160435.1.48169 WP_000160435.1.48186 WP_000160435.1.48187 WP_000160435.1.48197 WP_000160435.1.48199 WP_000160435.1.48205 WP_000160435.1.48212 WP_000160435.1.48223 WP_000160435.1.48227 WP_000160435.1.48236 WP_000160435.1.48250 WP_000160435.1.48272 WP_000160435.1.48282 WP_000160435.1.48284 WP_000160435.1.48307 WP_000160435.1.48310 WP_000160435.1.48322 WP_000160435.1.48326 WP_000160435.1.48338 WP_000160435.1.48364 WP_000160435.1.48376 WP_000160435.1.48391 WP_000160435.1.48394 WP_000160435.1.48398 WP_000160435.1.484 WP_000160435.1.4840 WP_000160435.1.48427 WP_000160435.1.48437 WP_000160435.1.48438 WP_000160435.1.48463 WP_000160435.1.48479 WP_000160435.1.48492 WP_000160435.1.4852 WP_000160435.1.48556 WP_000160435.1.48563 WP_000160435.1.48577 WP_000160435.1.48580 WP_000160435.1.48593 WP_000160435.1.48601 WP_000160435.1.48634 WP_000160435.1.48655 WP_000160435.1.48656 WP_000160435.1.48664 WP_000160435.1.48670 WP_000160435.1.4868 WP_000160435.1.48694 WP_000160435.1.48705 WP_000160435.1.48711 WP_000160435.1.48723 WP_000160435.1.48769 WP_000160435.1.48782 WP_000160435.1.48786 WP_000160435.1.48805 WP_000160435.1.48817 WP_000160435.1.48823 WP_000160435.1.48833 WP_000160435.1.48835 WP_000160435.1.4886 WP_000160435.1.48869 WP_000160435.1.48936 WP_000160435.1.48941 WP_000160435.1.48943 WP_000160435.1.48945 WP_000160435.1.48951 WP_000160435.1.48968 WP_000160435.1.48982 WP_000160435.1.48993 WP_000160435.1.4901 WP_000160435.1.49018 WP_000160435.1.49032 WP_000160435.1.4905 WP_000160435.1.49071 WP_000160435.1.49094 WP_000160435.1.49105 WP_000160435.1.49128 WP_000160435.1.49129 WP_000160435.1.49143 WP_000160435.1.49150 WP_000160435.1.49152 WP_000160435.1.49159 WP_000160435.1.4916 WP_000160435.1.49161 WP_000160435.1.4917 WP_000160435.1.49171 WP_000160435.1.4918 WP_000160435.1.49189 WP_000160435.1.49196 WP_000160435.1.49199 WP_000160435.1.49207 WP_000160435.1.4921 WP_000160435.1.4924 WP_000160435.1.49248 WP_000160435.1.49257 WP_000160435.1.49301 WP_000160435.1.49326 WP_000160435.1.49327 WP_000160435.1.49362 WP_000160435.1.49367 WP_000160435.1.49373 WP_000160435.1.49398 WP_000160435.1.49418 WP_000160435.1.49444 WP_000160435.1.4945 WP_000160435.1.49479 WP_000160435.1.49484 WP_000160435.1.4950 WP_000160435.1.49518 WP_000160435.1.49539 WP_000160435.1.49549 WP_000160435.1.49573 WP_000160435.1.49581 WP_000160435.1.49582 WP_000160435.1.496 WP_000160435.1.49603 WP_000160435.1.49605 WP_000160435.1.4962 WP_000160435.1.49643 WP_000160435.1.49653 WP_000160435.1.49658 WP_000160435.1.49669 WP_000160435.1.49671 WP_000160435.1.49672 WP_000160435.1.49690 WP_000160435.1.49707 WP_000160435.1.49728 WP_000160435.1.49730 WP_000160435.1.49732 WP_000160435.1.49742 WP_000160435.1.49745 WP_000160435.1.49757 WP_000160435.1.4980 WP_000160435.1.49800 WP_000160435.1.49819 WP_000160435.1.4982 WP_000160435.1.4984 WP_000160435.1.49860 WP_000160435.1.49863 WP_000160435.1.4987 WP_000160435.1.49871 WP_000160435.1.4989 WP_000160435.1.49894 WP_000160435.1.49907 WP_000160435.1.49912 WP_000160435.1.49917 WP_000160435.1.49918 WP_000160435.1.49921 WP_000160435.1.49934 WP_000160435.1.49935 WP_000160435.1.4994 WP_000160435.1.49943 WP_000160435.1.49951 WP_000160435.1.49970 WP_000160435.1.49982 WP_000160435.1.50013 WP_000160435.1.50023 WP_000160435.1.50028 WP_000160435.1.50038 WP_000160435.1.50039 WP_000160435.1.50061 WP_000160435.1.50064 WP_000160435.1.50076 WP_000160435.1.50117 WP_000160435.1.5013 WP_000160435.1.50138 WP_000160435.1.50145 WP_000160435.1.50175 WP_000160435.1.50178 WP_000160435.1.50192 WP_000160435.1.50212 WP_000160435.1.50217 WP_000160435.1.50219 WP_000160435.1.50261 WP_000160435.1.50291 WP_000160435.1.50313 WP_000160435.1.50314 WP_000160435.1.5035 WP_000160435.1.50356 WP_000160435.1.50367 WP_000160435.1.50369 WP_000160435.1.50377 WP_000160435.1.50388 WP_000160435.1.50424 WP_000160435.1.50425 WP_000160435.1.50430 WP_000160435.1.50440 WP_000160435.1.5045 WP_000160435.1.50464 WP_000160435.1.50477 WP_000160435.1.50525 WP_000160435.1.50527 WP_000160435.1.50536 WP_000160435.1.50543 WP_000160435.1.50555 WP_000160435.1.50556 WP_000160435.1.50558 WP_000160435.1.50568 WP_000160435.1.50578 WP_000160435.1.5059 WP_000160435.1.50594 WP_000160435.1.50595 WP_000160435.1.50647 WP_000160435.1.50660 WP_000160435.1.50699 WP_000160435.1.50732 WP_000160435.1.50740 WP_000160435.1.50742 WP_000160435.1.50748 WP_000160435.1.50768 WP_000160435.1.50799 WP_000160435.1.50817 WP_000160435.1.50820 WP_000160435.1.50829 WP_000160435.1.5087 WP_000160435.1.50884 WP_000160435.1.50896 WP_000160435.1.50937 WP_000160435.1.50958 WP_000160435.1.50962 WP_000160435.1.50974 WP_000160435.1.51015 WP_000160435.1.51031 WP_000160435.1.5108 WP_000160435.1.5109 WP_000160435.1.5110 WP_000160435.1.5111 WP_000160435.1.51130 WP_000160435.1.51152 WP_000160435.1.5117 WP_000160435.1.51194 WP_000160435.1.51209 WP_000160435.1.51220 WP_000160435.1.51226 WP_000160435.1.51236 WP_000160435.1.51245 WP_000160435.1.51250 WP_000160435.1.51271 WP_000160435.1.51277 WP_000160435.1.51282 WP_000160435.1.51295 WP_000160435.1.51306 WP_000160435.1.51310 WP_000160435.1.51326 WP_000160435.1.51346 WP_000160435.1.51365 WP_000160435.1.51376 WP_000160435.1.51377 WP_000160435.1.51393 WP_000160435.1.51403 WP_000160435.1.51418 WP_000160435.1.5145 WP_000160435.1.51454 WP_000160435.1.51456 WP_000160435.1.51465 WP_000160435.1.51469 WP_000160435.1.51492 WP_000160435.1.51496 WP_000160435.1.515 WP_000160435.1.51527 WP_000160435.1.5155 WP_000160435.1.51557 WP_000160435.1.51559 WP_000160435.1.51571 WP_000160435.1.51575 WP_000160435.1.51590 WP_000160435.1.51619 WP_000160435.1.51623 WP_000160435.1.51657 WP_000160435.1.51665 WP_000160435.1.51672 WP_000160435.1.51702 WP_000160435.1.51713 WP_000160435.1.51716 WP_000160435.1.51741 WP_000160435.1.51744 WP_000160435.1.51748 WP_000160435.1.51751 WP_000160435.1.51797 WP_000160435.1.51824 WP_000160435.1.51836 WP_000160435.1.51842 WP_000160435.1.5186 WP_000160435.1.51866 WP_000160435.1.51871 WP_000160435.1.51883 WP_000160435.1.51912 WP_000160435.1.51924 WP_000160435.1.51936 WP_000160435.1.51952 WP_000160435.1.51995 WP_000160435.1.52034 WP_000160435.1.52061 WP_000160435.1.52072 WP_000160435.1.52078 WP_000160435.1.5209 WP_000160435.1.521 WP_000160435.1.5213 WP_000160435.1.52151 WP_000160435.1.52182 WP_000160435.1.52185 WP_000160435.1.52193 WP_000160435.1.52195 WP_000160435.1.52198 WP_000160435.1.52210 WP_000160435.1.52224 WP_000160435.1.52251 WP_000160435.1.5228 WP_000160435.1.52289 WP_000160435.1.52296 WP_000160435.1.523 WP_000160435.1.52308 WP_000160435.1.5231 WP_000160435.1.52322 WP_000160435.1.52327 WP_000160435.1.52331 WP_000160435.1.52340 WP_000160435.1.52343 WP_000160435.1.52377 WP_000160435.1.52396 WP_000160435.1.52423 WP_000160435.1.52427 WP_000160435.1.52440 WP_000160435.1.52442 WP_000160435.1.52452 WP_000160435.1.52463 WP_000160435.1.52464 WP_000160435.1.5251 WP_000160435.1.52511 WP_000160435.1.52518 WP_000160435.1.52548 WP_000160435.1.52595 WP_000160435.1.52602 WP_000160435.1.52605 WP_000160435.1.52622 WP_000160435.1.52623 WP_000160435.1.52624 WP_000160435.1.52645 WP_000160435.1.52660 WP_000160435.1.52687 WP_000160435.1.52699 WP_000160435.1.52715 WP_000160435.1.52722 WP_000160435.1.52828 WP_000160435.1.52830 WP_000160435.1.52848 WP_000160435.1.52865 WP_000160435.1.52877 WP_000160435.1.52878 WP_000160435.1.52886 WP_000160435.1.52889 WP_000160435.1.52900 WP_000160435.1.52941 WP_000160435.1.52947 WP_000160435.1.52965 WP_000160435.1.52983 WP_000160435.1.52984 WP_000160435.1.52992 WP_000160435.1.53002 WP_000160435.1.53022 WP_000160435.1.5304 WP_000160435.1.53050 WP_000160435.1.53057 WP_000160435.1.53060 WP_000160435.1.53069 WP_000160435.1.53071 WP_000160435.1.53109 WP_000160435.1.53140 WP_000160435.1.53153 WP_000160435.1.53178 WP_000160435.1.5319 WP_000160435.1.53209 WP_000160435.1.5321 WP_000160435.1.53245 WP_000160435.1.53260 WP_000160435.1.53285 WP_000160435.1.53312 WP_000160435.1.53317 WP_000160435.1.53319 WP_000160435.1.53323 WP_000160435.1.53352 WP_000160435.1.5336 WP_000160435.1.53363 WP_000160435.1.53366 WP_000160435.1.53372 WP_000160435.1.53373 WP_000160435.1.53379 WP_000160435.1.53383 WP_000160435.1.53387 WP_000160435.1.53394 WP_000160435.1.53403 WP_000160435.1.53408 WP_000160435.1.53418 WP_000160435.1.53432 WP_000160435.1.53433 WP_000160435.1.53444 WP_000160435.1.53462 WP_000160435.1.53467 WP_000160435.1.5347 WP_000160435.1.53488 WP_000160435.1.53503 WP_000160435.1.53521 WP_000160435.1.53532 WP_000160435.1.53577 WP_000160435.1.53641 WP_000160435.1.53648 WP_000160435.1.53671 WP_000160435.1.53691 WP_000160435.1.53758 WP_000160435.1.53759 WP_000160435.1.53766 WP_000160435.1.53774 WP_000160435.1.53799 WP_000160435.1.5382 WP_000160435.1.53827 WP_000160435.1.53835 WP_000160435.1.53889 WP_000160435.1.53911 WP_000160435.1.53915 WP_000160435.1.53924 WP_000160435.1.53926 WP_000160435.1.53934 WP_000160435.1.53969 WP_000160435.1.53999 WP_000160435.1.5401 WP_000160435.1.54022 WP_000160435.1.54049 WP_000160435.1.54074 WP_000160435.1.54086 WP_000160435.1.54094 WP_000160435.1.54109 WP_000160435.1.54147 WP_000160435.1.54161 WP_000160435.1.54199 WP_000160435.1.54229 WP_000160435.1.54237 WP_000160435.1.54253 WP_000160435.1.54282 WP_000160435.1.54290 WP_000160435.1.54297 WP_000160435.1.54299 WP_000160435.1.54332 WP_000160435.1.54373 WP_000160435.1.54395 WP_000160435.1.544 WP_000160435.1.54404 WP_000160435.1.54413 WP_000160435.1.54426 WP_000160435.1.54438 WP_000160435.1.54446 WP_000160435.1.54471 WP_000160435.1.54479 WP_000160435.1.54485 WP_000160435.1.54491 WP_000160435.1.54503 WP_000160435.1.54510 WP_000160435.1.54518 WP_000160435.1.54539 WP_000160435.1.54543 WP_000160435.1.54551 WP_000160435.1.54554 WP_000160435.1.54572 WP_000160435.1.54574 WP_000160435.1.54637 WP_000160435.1.54675 WP_000160435.1.54689 WP_000160435.1.5469 WP_000160435.1.54728 WP_000160435.1.54733 WP_000160435.1.54744 WP_000160435.1.54745 WP_000160435.1.54753 WP_000160435.1.54819 WP_000160435.1.54826 WP_000160435.1.54830 WP_000160435.1.54851 WP_000160435.1.54878 WP_000160435.1.54929 WP_000160435.1.54955 WP_000160435.1.54967 WP_000160435.1.54990 WP_000160435.1.54995 WP_000160435.1.5500 WP_000160435.1.55004 WP_000160435.1.55058 WP_000160435.1.55082 WP_000160435.1.55084 WP_000160435.1.55095 WP_000160435.1.55100 WP_000160435.1.55139 WP_000160435.1.5518 WP_000160435.1.5519 WP_000160435.1.55192 WP_000160435.1.552 WP_000160435.1.55214 WP_000160435.1.55220 WP_000160435.1.55239 WP_000160435.1.55271 WP_000160435.1.55272 WP_000160435.1.55274 WP_000160435.1.55301 WP_000160435.1.55306 WP_000160435.1.55309 WP_000160435.1.55327 WP_000160435.1.55336 WP_000160435.1.55353 WP_000160435.1.5536 WP_000160435.1.55367 WP_000160435.1.55369 WP_000160435.1.55403 WP_000160435.1.55405 WP_000160435.1.55419 WP_000160435.1.55421 WP_000160435.1.55442 WP_000160435.1.55495 WP_000160435.1.5550 WP_000160435.1.55508 WP_000160435.1.55527 WP_000160435.1.55535 WP_000160435.1.55538 WP_000160435.1.5554 WP_000160435.1.55544 WP_000160435.1.55558 WP_000160435.1.5556 WP_000160435.1.55573 WP_000160435.1.55583 WP_000160435.1.5559 WP_000160435.1.55603 WP_000160435.1.5562 WP_000160435.1.55628 WP_000160435.1.55637 WP_000160435.1.55653 WP_000160435.1.55657 WP_000160435.1.557 WP_000160435.1.55717 WP_000160435.1.55719 WP_000160435.1.55724 WP_000160435.1.55728 WP_000160435.1.55746 WP_000160435.1.55784 WP_000160435.1.55786 WP_000160435.1.5580 WP_000160435.1.55818 WP_000160435.1.55831 WP_000160435.1.55835 WP_000160435.1.55845 WP_000160435.1.55854 WP_000160435.1.55867 WP_000160435.1.55874 WP_000160435.1.55886 WP_000160435.1.5589 WP_000160435.1.5590 WP_000160435.1.55904 WP_000160435.1.55916 WP_000160435.1.55933 WP_000160435.1.55949 WP_000160435.1.55953 WP_000160435.1.55955 WP_000160435.1.55960 WP_000160435.1.55985 WP_000160435.1.56000 WP_000160435.1.56003 WP_000160435.1.56025 WP_000160435.1.56039 WP_000160435.1.5604 WP_000160435.1.56048 WP_000160435.1.56064 WP_000160435.1.56078 WP_000160435.1.56098 WP_000160435.1.56106 WP_000160435.1.56135 WP_000160435.1.56153 WP_000160435.1.56159 WP_000160435.1.56200 WP_000160435.1.56214 WP_000160435.1.56220 WP_000160435.1.56225 WP_000160435.1.5623 WP_000160435.1.56239 WP_000160435.1.56265 WP_000160435.1.56281 WP_000160435.1.56332 WP_000160435.1.56333 WP_000160435.1.56343 WP_000160435.1.5635 WP_000160435.1.5637 WP_000160435.1.56377 WP_000160435.1.56387 WP_000160435.1.56400 WP_000160435.1.5644 WP_000160435.1.56444 WP_000160435.1.56453 WP_000160435.1.56464 WP_000160435.1.56482 WP_000160435.1.56496 WP_000160435.1.56527 WP_000160435.1.56530 WP_000160435.1.56542 WP_000160435.1.56558 WP_000160435.1.56570 WP_000160435.1.5658 WP_000160435.1.56584 WP_000160435.1.56598 WP_000160435.1.56608 WP_000160435.1.56619 WP_000160435.1.56628 WP_000160435.1.56641 WP_000160435.1.5665 WP_000160435.1.56658 WP_000160435.1.5666 WP_000160435.1.56696 WP_000160435.1.56702 WP_000160435.1.56708 WP_000160435.1.56722 WP_000160435.1.56723 WP_000160435.1.56737 WP_000160435.1.5675 WP_000160435.1.56767 WP_000160435.1.5677 WP_000160435.1.56772 WP_000160435.1.56778 WP_000160435.1.56779 WP_000160435.1.56794 WP_000160435.1.56806 WP_000160435.1.56815 WP_000160435.1.56822 WP_000160435.1.56856 WP_000160435.1.5686 WP_000160435.1.56865 WP_000160435.1.56878 WP_000160435.1.569 WP_000160435.1.56903 WP_000160435.1.56931 WP_000160435.1.56966 WP_000160435.1.56975 WP_000160435.1.56986 WP_000160435.1.57015 WP_000160435.1.57024 WP_000160435.1.57047 WP_000160435.1.5705 WP_000160435.1.57073 WP_000160435.1.57075 WP_000160435.1.57080 WP_000160435.1.57081 WP_000160435.1.57097 WP_000160435.1.57109 WP_000160435.1.57115 WP_000160435.1.57141 WP_000160435.1.57170 WP_000160435.1.57175 WP_000160435.1.5718 WP_000160435.1.57190 WP_000160435.1.57196 WP_000160435.1.57214 WP_000160435.1.57223 WP_000160435.1.57265 WP_000160435.1.57309 WP_000160435.1.57316 WP_000160435.1.57330 WP_000160435.1.57338 WP_000160435.1.57370 WP_000160435.1.57376 WP_000160435.1.57389 WP_000160435.1.57427 WP_000160435.1.57445 WP_000160435.1.57448 WP_000160435.1.57459 WP_000160435.1.57481 WP_000160435.1.5749 WP_000160435.1.57507 WP_000160435.1.57577 WP_000160435.1.57593 WP_000160435.1.57594 WP_000160435.1.5763 WP_000160435.1.57650 WP_000160435.1.57665 WP_000160435.1.57670 WP_000160435.1.57682 WP_000160435.1.57692 WP_000160435.1.57693 WP_000160435.1.5770 WP_000160435.1.57701 WP_000160435.1.57718 WP_000160435.1.57720 WP_000160435.1.57723 WP_000160435.1.57727 WP_000160435.1.57730 WP_000160435.1.57734 WP_000160435.1.57745 WP_000160435.1.57754 WP_000160435.1.57761 WP_000160435.1.57770 WP_000160435.1.57783 WP_000160435.1.57808 WP_000160435.1.57819 WP_000160435.1.57837 WP_000160435.1.57840 WP_000160435.1.57844 WP_000160435.1.57861 WP_000160435.1.57875 WP_000160435.1.57878 WP_000160435.1.57888 WP_000160435.1.579 WP_000160435.1.5791 WP_000160435.1.57910 WP_000160435.1.57915 WP_000160435.1.57943 WP_000160435.1.57944 WP_000160435.1.57952 WP_000160435.1.57962 WP_000160435.1.57974 WP_000160435.1.5799 WP_000160435.1.58005 WP_000160435.1.58006 WP_000160435.1.58014 WP_000160435.1.58016 WP_000160435.1.58035 WP_000160435.1.58049 WP_000160435.1.58050 WP_000160435.1.58051 WP_000160435.1.58074 WP_000160435.1.58116 WP_000160435.1.58122 WP_000160435.1.58127 WP_000160435.1.58148 WP_000160435.1.58158 WP_000160435.1.5816 WP_000160435.1.5817 WP_000160435.1.58175 WP_000160435.1.58185 WP_000160435.1.58198 WP_000160435.1.58212 WP_000160435.1.58241 WP_000160435.1.58246 WP_000160435.1.58277 WP_000160435.1.58317 WP_000160435.1.58325 WP_000160435.1.58350 WP_000160435.1.58352 WP_000160435.1.58353 WP_000160435.1.58364 WP_000160435.1.58366 WP_000160435.1.58373 WP_000160435.1.58388 WP_000160435.1.58392 WP_000160435.1.58395 WP_000160435.1.58413 WP_000160435.1.58419 WP_000160435.1.58421 WP_000160435.1.58430 WP_000160435.1.58435 WP_000160435.1.58473 WP_000160435.1.58481 WP_000160435.1.5849 WP_000160435.1.58495 WP_000160435.1.58497 WP_000160435.1.58504 WP_000160435.1.58508 WP_000160435.1.58512 WP_000160435.1.58521 WP_000160435.1.58530 WP_000160435.1.58538 WP_000160435.1.58549 WP_000160435.1.5857 WP_000160435.1.58571 WP_000160435.1.58592 WP_000160435.1.58598 WP_000160435.1.586 WP_000160435.1.58603 WP_000160435.1.58626 WP_000160435.1.58686 WP_000160435.1.58701 WP_000160435.1.58704 WP_000160435.1.58714 WP_000160435.1.58718 WP_000160435.1.58735 WP_000160435.1.58760 WP_000160435.1.58763 WP_000160435.1.58772 WP_000160435.1.58775 WP_000160435.1.58798 WP_000160435.1.5880 WP_000160435.1.58833 WP_000160435.1.58855 WP_000160435.1.58934 WP_000160435.1.58960 WP_000160435.1.58981 WP_000160435.1.58991 WP_000160435.1.58998 WP_000160435.1.5901 WP_000160435.1.59011 WP_000160435.1.59014 WP_000160435.1.59039 WP_000160435.1.5904 WP_000160435.1.59046 WP_000160435.1.59062 WP_000160435.1.59077 WP_000160435.1.59098 WP_000160435.1.59124 WP_000160435.1.59133 WP_000160435.1.59135 WP_000160435.1.59146 WP_000160435.1.59157 WP_000160435.1.59187 WP_000160435.1.5920 WP_000160435.1.59203 WP_000160435.1.59213 WP_000160435.1.5925 WP_000160435.1.59269 WP_000160435.1.59284 WP_000160435.1.59311 WP_000160435.1.59327 WP_000160435.1.59329 WP_000160435.1.59337 WP_000160435.1.59363 WP_000160435.1.59380 WP_000160435.1.59397 WP_000160435.1.59398 WP_000160435.1.5940 WP_000160435.1.59401 WP_000160435.1.59404 WP_000160435.1.59441 WP_000160435.1.59457 WP_000160435.1.59459 WP_000160435.1.59462 WP_000160435.1.59464 WP_000160435.1.59467 WP_000160435.1.59478 WP_000160435.1.59489 WP_000160435.1.59498 WP_000160435.1.59540 WP_000160435.1.59546 WP_000160435.1.59547 WP_000160435.1.59598 WP_000160435.1.59603 WP_000160435.1.59609 WP_000160435.1.59624 WP_000160435.1.59629 WP_000160435.1.59643 WP_000160435.1.59663 WP_000160435.1.59668 WP_000160435.1.59669 WP_000160435.1.59671 WP_000160435.1.59697 WP_000160435.1.5972 WP_000160435.1.59736 WP_000160435.1.59787 WP_000160435.1.59803 WP_000160435.1.59819 WP_000160435.1.5982 WP_000160435.1.59874 WP_000160435.1.59881 WP_000160435.1.59886 WP_000160435.1.59896 WP_000160435.1.59907 WP_000160435.1.59915 WP_000160435.1.59921 WP_000160435.1.59945 WP_000160435.1.59977 WP_000160435.1.60001 WP_000160435.1.60006 WP_000160435.1.60022 WP_000160435.1.6006 WP_000160435.1.60086 WP_000160435.1.60101 WP_000160435.1.60107 WP_000160435.1.6011 WP_000160435.1.60123 WP_000160435.1.60124 WP_000160435.1.60147 WP_000160435.1.60149 WP_000160435.1.60156 WP_000160435.1.60157 WP_000160435.1.6017 WP_000160435.1.60181 WP_000160435.1.60201 WP_000160435.1.60227 WP_000160435.1.60259 WP_000160435.1.60280 WP_000160435.1.60302 WP_000160435.1.60307 WP_000160435.1.6034 WP_000160435.1.60345 WP_000160435.1.60353 WP_000160435.1.60360 WP_000160435.1.60368 WP_000160435.1.60382 WP_000160435.1.60414 WP_000160435.1.60434 WP_000160435.1.60462 WP_000160435.1.60473 WP_000160435.1.60492 WP_000160435.1.60493 WP_000160435.1.60515 WP_000160435.1.60530 WP_000160435.1.60547 WP_000160435.1.60551 WP_000160435.1.60585 WP_000160435.1.60594 WP_000160435.1.60595 WP_000160435.1.60641 WP_000160435.1.60675 WP_000160435.1.60677 WP_000160435.1.60690 WP_000160435.1.60696 WP_000160435.1.60734 WP_000160435.1.60750 WP_000160435.1.60751 WP_000160435.1.60758 WP_000160435.1.60759 WP_000160435.1.60765 WP_000160435.1.60778 WP_000160435.1.60787 WP_000160435.1.60813 WP_000160435.1.60820 WP_000160435.1.60845 WP_000160435.1.6085 WP_000160435.1.60869 WP_000160435.1.60888 WP_000160435.1.60898 WP_000160435.1.60912 WP_000160435.1.60917 WP_000160435.1.60923 WP_000160435.1.60939 WP_000160435.1.60943 WP_000160435.1.60946 WP_000160435.1.60948 WP_000160435.1.60949 WP_000160435.1.60965 WP_000160435.1.60981 WP_000160435.1.60982 WP_000160435.1.60991 WP_000160435.1.61009 WP_000160435.1.61013 WP_000160435.1.61023 WP_000160435.1.61026 WP_000160435.1.61029 WP_000160435.1.61030 WP_000160435.1.61031 WP_000160435.1.61077 WP_000160435.1.61082 WP_000160435.1.61107 WP_000160435.1.61115 WP_000160435.1.61119 WP_000160435.1.61139 WP_000160435.1.61152 WP_000160435.1.61153 WP_000160435.1.6118 WP_000160435.1.61187 WP_000160435.1.61188 WP_000160435.1.61189 WP_000160435.1.6119 WP_000160435.1.61215 WP_000160435.1.61224 WP_000160435.1.6123 WP_000160435.1.61257 WP_000160435.1.61261 WP_000160435.1.61263 WP_000160435.1.61271 WP_000160435.1.61277 WP_000160435.1.61286 WP_000160435.1.61289 WP_000160435.1.61313 WP_000160435.1.61316 WP_000160435.1.61324 WP_000160435.1.61339 WP_000160435.1.61353 WP_000160435.1.6136 WP_000160435.1.61375 WP_000160435.1.61393 WP_000160435.1.61394 WP_000160435.1.61408 WP_000160435.1.61413 WP_000160435.1.61421 WP_000160435.1.61430 WP_000160435.1.61439 WP_000160435.1.61440 WP_000160435.1.61547 WP_000160435.1.61555 WP_000160435.1.61564 WP_000160435.1.61585 WP_000160435.1.61591 WP_000160435.1.61597 WP_000160435.1.61615 WP_000160435.1.61639 WP_000160435.1.61641 WP_000160435.1.6166 WP_000160435.1.6168 WP_000160435.1.61687 WP_000160435.1.6170 WP_000160435.1.61705 WP_000160435.1.61747 WP_000160435.1.61749 WP_000160435.1.61784 WP_000160435.1.61800 WP_000160435.1.61802 WP_000160435.1.61838 WP_000160435.1.61864 WP_000160435.1.6189 WP_000160435.1.61897 WP_000160435.1.619 WP_000160435.1.61903 WP_000160435.1.61910 WP_000160435.1.61921 WP_000160435.1.61936 WP_000160435.1.61970 WP_000160435.1.61975 WP_000160435.1.61978 WP_000160435.1.62002 WP_000160435.1.6201 WP_000160435.1.62028 WP_000160435.1.62030 WP_000160435.1.62069 WP_000160435.1.62071 WP_000160435.1.6208 WP_000160435.1.62084 WP_000160435.1.62085 WP_000160435.1.62093 WP_000160435.1.62096 WP_000160435.1.62140 WP_000160435.1.62160 WP_000160435.1.62164 WP_000160435.1.62229 WP_000160435.1.62247 WP_000160435.1.62253 WP_000160435.1.62254 WP_000160435.1.62265 WP_000160435.1.62318 WP_000160435.1.6234 WP_000160435.1.62346 WP_000160435.1.62352 WP_000160435.1.62367 WP_000160435.1.62382 WP_000160435.1.62383 WP_000160435.1.62398 WP_000160435.1.62409 WP_000160435.1.62414 WP_000160435.1.62429 WP_000160435.1.62437 WP_000160435.1.62453 WP_000160435.1.62459 WP_000160435.1.62474 WP_000160435.1.62482 WP_000160435.1.62492 WP_000160435.1.62496 WP_000160435.1.6250 WP_000160435.1.62537 WP_000160435.1.62539 WP_000160435.1.62553 WP_000160435.1.62575 WP_000160435.1.62602 WP_000160435.1.62608 WP_000160435.1.62621 WP_000160435.1.62625 WP_000160435.1.62630 WP_000160435.1.62653 WP_000160435.1.62671 WP_000160435.1.62674 WP_000160435.1.6268 WP_000160435.1.62684 WP_000160435.1.62685 WP_000160435.1.62723 WP_000160435.1.62740 WP_000160435.1.62756 WP_000160435.1.62764 WP_000160435.1.62771 WP_000160435.1.62781 WP_000160435.1.62796 WP_000160435.1.62808 WP_000160435.1.62822 WP_000160435.1.62824 WP_000160435.1.62829 WP_000160435.1.62831 WP_000160435.1.62842 WP_000160435.1.62860 WP_000160435.1.62863 WP_000160435.1.62878 WP_000160435.1.62880 WP_000160435.1.62927 WP_000160435.1.62956 WP_000160435.1.62970 WP_000160435.1.62974 WP_000160435.1.6298 WP_000160435.1.62998 WP_000160435.1.63003 WP_000160435.1.63004 WP_000160435.1.63011 WP_000160435.1.63027 WP_000160435.1.63040 WP_000160435.1.63050 WP_000160435.1.63052 WP_000160435.1.63062 WP_000160435.1.63070 WP_000160435.1.63083 WP_000160435.1.63085 WP_000160435.1.631 WP_000160435.1.63131 WP_000160435.1.63132 WP_000160435.1.63139 WP_000160435.1.63140 WP_000160435.1.63142 WP_000160435.1.63162 WP_000160435.1.63170 WP_000160435.1.63182 WP_000160435.1.63195 WP_000160435.1.63215 WP_000160435.1.63220 WP_000160435.1.63233 WP_000160435.1.63244 WP_000160435.1.63266 WP_000160435.1.63273 WP_000160435.1.63279 WP_000160435.1.63280 WP_000160435.1.63289 WP_000160435.1.63296 WP_000160435.1.63304 WP_000160435.1.63307 WP_000160435.1.63313 WP_000160435.1.63319 WP_000160435.1.63322 WP_000160435.1.63324 WP_000160435.1.63333 WP_000160435.1.63335 WP_000160435.1.63341 WP_000160435.1.63364 WP_000160435.1.63365 WP_000160435.1.63383 WP_000160435.1.634 WP_000160435.1.63406 WP_000160435.1.63411 WP_000160435.1.63421 WP_000160435.1.63441 WP_000160435.1.63460 WP_000160435.1.63469 WP_000160435.1.63471 WP_000160435.1.63510 WP_000160435.1.63527 WP_000160435.1.63565 WP_000160435.1.63589 WP_000160435.1.63617 WP_000160435.1.63673 WP_000160435.1.63678 WP_000160435.1.63693 WP_000160435.1.63705 WP_000160435.1.63726 WP_000160435.1.63729 WP_000160435.1.6374 WP_000160435.1.63751 WP_000160435.1.63759 WP_000160435.1.63760 WP_000160435.1.63774 WP_000160435.1.6378 WP_000160435.1.63828 WP_000160435.1.63847 WP_000160435.1.63874 WP_000160435.1.63878 WP_000160435.1.6388 WP_000160435.1.63894 WP_000160435.1.63895 WP_000160435.1.63907 WP_000160435.1.63910 WP_000160435.1.63937 WP_000160435.1.63947 WP_000160435.1.63975 WP_000160435.1.63978 WP_000160435.1.63987 WP_000160435.1.64012 WP_000160435.1.6403 WP_000160435.1.6408 WP_000160435.1.64094 WP_000160435.1.64108 WP_000160435.1.6412 WP_000160435.1.64127 WP_000160435.1.64192 WP_000160435.1.64207 WP_000160435.1.64230 WP_000160435.1.64234 WP_000160435.1.64250 WP_000160435.1.64251 WP_000160435.1.64288 WP_000160435.1.64303 WP_000160435.1.64304 WP_000160435.1.64351 WP_000160435.1.64367 WP_000160435.1.64368 WP_000160435.1.6438 WP_000160435.1.64397 WP_000160435.1.64400 WP_000160435.1.64440 WP_000160435.1.64456 WP_000160435.1.64457 WP_000160435.1.64473 WP_000160435.1.64525 WP_000160435.1.64549 WP_000160435.1.64565 WP_000160435.1.64583 WP_000160435.1.6459 WP_000160435.1.64598 WP_000160435.1.6462 WP_000160435.1.64628 WP_000160435.1.64630 WP_000160435.1.64631 WP_000160435.1.64643 WP_000160435.1.64665 WP_000160435.1.64677 WP_000160435.1.64686 WP_000160435.1.64720 WP_000160435.1.64765 WP_000160435.1.6479 WP_000160435.1.64811 WP_000160435.1.64845 WP_000160435.1.64858 WP_000160435.1.64860 WP_000160435.1.64873 WP_000160435.1.64879 WP_000160435.1.6488 WP_000160435.1.64893 WP_000160435.1.64896 WP_000160435.1.64897 WP_000160435.1.64899 WP_000160435.1.64928 WP_000160435.1.64935 WP_000160435.1.64951 WP_000160435.1.64956 WP_000160435.1.64961 WP_000160435.1.64988 WP_000160435.1.64996 WP_000160435.1.64998 WP_000160435.1.65025 WP_000160435.1.65033 WP_000160435.1.65038 WP_000160435.1.65044 WP_000160435.1.65046 WP_000160435.1.65076 WP_000160435.1.65082 WP_000160435.1.65125 WP_000160435.1.65132 WP_000160435.1.65153 WP_000160435.1.65156 WP_000160435.1.65158 WP_000160435.1.65180 WP_000160435.1.65193 WP_000160435.1.65203 WP_000160435.1.65214 WP_000160435.1.65217 WP_000160435.1.65233 WP_000160435.1.65243 WP_000160435.1.65259 WP_000160435.1.65264 WP_000160435.1.6531 WP_000160435.1.65317 WP_000160435.1.65358 WP_000160435.1.65361 WP_000160435.1.65367 WP_000160435.1.65387 WP_000160435.1.65406 WP_000160435.1.65407 WP_000160435.1.65419 WP_000160435.1.65423 WP_000160435.1.65432 WP_000160435.1.6544 WP_000160435.1.65443 WP_000160435.1.65448 WP_000160435.1.65451 WP_000160435.1.6547 WP_000160435.1.65470 WP_000160435.1.65504 WP_000160435.1.6551 WP_000160435.1.65520 WP_000160435.1.65541 WP_000160435.1.65544 WP_000160435.1.65555 WP_000160435.1.65562 WP_000160435.1.65585 WP_000160435.1.65600 WP_000160435.1.65616 WP_000160435.1.65629 WP_000160435.1.65643 WP_000160435.1.65653 WP_000160435.1.65656 WP_000160435.1.65663 WP_000160435.1.65675 WP_000160435.1.6568 WP_000160435.1.65689 WP_000160435.1.65693 WP_000160435.1.65700 WP_000160435.1.65703 WP_000160435.1.65705 WP_000160435.1.65713 WP_000160435.1.65734 WP_000160435.1.65750 WP_000160435.1.65752 WP_000160435.1.65769 WP_000160435.1.65808 WP_000160435.1.65809 WP_000160435.1.65842 WP_000160435.1.6585 WP_000160435.1.65856 WP_000160435.1.65870 WP_000160435.1.65886 WP_000160435.1.65892 WP_000160435.1.65922 WP_000160435.1.65931 WP_000160435.1.65935 WP_000160435.1.65947 WP_000160435.1.65948 WP_000160435.1.65965 WP_000160435.1.66009 WP_000160435.1.6603 WP_000160435.1.66035 WP_000160435.1.66054 WP_000160435.1.66056 WP_000160435.1.66069 WP_000160435.1.66073 WP_000160435.1.66081 WP_000160435.1.661 WP_000160435.1.6612 WP_000160435.1.66120 WP_000160435.1.66130 WP_000160435.1.66133 WP_000160435.1.66144 WP_000160435.1.66175 WP_000160435.1.66262 WP_000160435.1.66265 WP_000160435.1.66281 WP_000160435.1.66287 WP_000160435.1.66298 WP_000160435.1.66302 WP_000160435.1.6632 WP_000160435.1.66322 WP_000160435.1.66366 WP_000160435.1.66369 WP_000160435.1.66433 WP_000160435.1.66453 WP_000160435.1.66505 WP_000160435.1.66513 WP_000160435.1.66519 WP_000160435.1.66542 WP_000160435.1.66554 WP_000160435.1.66556 WP_000160435.1.66564 WP_000160435.1.66576 WP_000160435.1.66588 WP_000160435.1.66598 WP_000160435.1.66601 WP_000160435.1.66606 WP_000160435.1.66611 WP_000160435.1.66614 WP_000160435.1.6662 WP_000160435.1.66655 WP_000160435.1.66664 WP_000160435.1.66677 WP_000160435.1.66705 WP_000160435.1.66711 WP_000160435.1.66712 WP_000160435.1.66726 WP_000160435.1.6674 WP_000160435.1.66756 WP_000160435.1.66766 WP_000160435.1.66786 WP_000160435.1.66803 WP_000160435.1.66816 WP_000160435.1.66818 WP_000160435.1.6684 WP_000160435.1.66879 WP_000160435.1.6688 WP_000160435.1.66938 WP_000160435.1.66969 WP_000160435.1.66979 WP_000160435.1.6700 WP_000160435.1.67006 WP_000160435.1.67012 WP_000160435.1.67014 WP_000160435.1.67067 WP_000160435.1.67072 WP_000160435.1.67090 WP_000160435.1.67112 WP_000160435.1.67113 WP_000160435.1.67135 WP_000160435.1.67155 WP_000160435.1.67160 WP_000160435.1.67191 WP_000160435.1.67204 WP_000160435.1.6722 WP_000160435.1.67251 WP_000160435.1.67259 WP_000160435.1.6726 WP_000160435.1.67266 WP_000160435.1.67286 WP_000160435.1.67294 WP_000160435.1.67296 WP_000160435.1.67297 WP_000160435.1.67312 WP_000160435.1.67328 WP_000160435.1.67329 WP_000160435.1.67333 WP_000160435.1.67379 WP_000160435.1.67384 WP_000160435.1.67386 WP_000160435.1.6740 WP_000160435.1.67414 WP_000160435.1.67418 WP_000160435.1.67420 WP_000160435.1.67425 WP_000160435.1.67447 WP_000160435.1.67457 WP_000160435.1.67460 WP_000160435.1.67463 WP_000160435.1.67480 WP_000160435.1.67505 WP_000160435.1.67507 WP_000160435.1.67513 WP_000160435.1.67520 WP_000160435.1.67521 WP_000160435.1.67540 WP_000160435.1.67554 WP_000160435.1.67572 WP_000160435.1.67609 WP_000160435.1.67612 WP_000160435.1.67618 WP_000160435.1.67621 WP_000160435.1.67632 WP_000160435.1.67644 WP_000160435.1.67651 WP_000160435.1.67652 WP_000160435.1.67653 WP_000160435.1.67691 WP_000160435.1.67703 WP_000160435.1.67712 WP_000160435.1.67713 WP_000160435.1.67722 WP_000160435.1.67752 WP_000160435.1.67754 WP_000160435.1.67762 WP_000160435.1.67767 WP_000160435.1.67806 WP_000160435.1.67815 WP_000160435.1.67834 WP_000160435.1.6786 WP_000160435.1.67865 WP_000160435.1.67867 WP_000160435.1.67880 WP_000160435.1.67889 WP_000160435.1.67900 WP_000160435.1.67925 WP_000160435.1.67941 WP_000160435.1.67986 WP_000160435.1.67991 WP_000160435.1.68001 WP_000160435.1.68033 WP_000160435.1.68054 WP_000160435.1.68066 WP_000160435.1.68101 WP_000160435.1.68102 WP_000160435.1.6811 WP_000160435.1.68111 WP_000160435.1.68134 WP_000160435.1.68139 WP_000160435.1.68141 WP_000160435.1.68152 WP_000160435.1.68160 WP_000160435.1.68161 WP_000160435.1.68199 WP_000160435.1.68202 WP_000160435.1.68219 WP_000160435.1.68221 WP_000160435.1.68223 WP_000160435.1.6824 WP_000160435.1.68261 WP_000160435.1.68268 WP_000160435.1.68286 WP_000160435.1.68295 WP_000160435.1.68296 WP_000160435.1.68299 WP_000160435.1.6830 WP_000160435.1.68307 WP_000160435.1.6834 WP_000160435.1.68343 WP_000160435.1.68351 WP_000160435.1.68355 WP_000160435.1.68366 WP_000160435.1.68367 WP_000160435.1.6839 WP_000160435.1.68397 WP_000160435.1.68398 WP_000160435.1.68399 WP_000160435.1.68404 WP_000160435.1.68416 WP_000160435.1.68425 WP_000160435.1.68476 WP_000160435.1.68479 WP_000160435.1.68483 WP_000160435.1.68489 WP_000160435.1.68504 WP_000160435.1.68505 WP_000160435.1.68512 WP_000160435.1.68522 WP_000160435.1.68542 WP_000160435.1.68548 WP_000160435.1.68565 WP_000160435.1.68575 WP_000160435.1.686 WP_000160435.1.68650 WP_000160435.1.68657 WP_000160435.1.68681 WP_000160435.1.68699 WP_000160435.1.68703 WP_000160435.1.68728 WP_000160435.1.68737 WP_000160435.1.68743 WP_000160435.1.68775 WP_000160435.1.68813 WP_000160435.1.68831 WP_000160435.1.68854 WP_000160435.1.68864 WP_000160435.1.68875 WP_000160435.1.68883 WP_000160435.1.68917 WP_000160435.1.68943 WP_000160435.1.68944 WP_000160435.1.68998 WP_000160435.1.69012 WP_000160435.1.69045 WP_000160435.1.69071 WP_000160435.1.69078 WP_000160435.1.69087 WP_000160435.1.69089 WP_000160435.1.691 WP_000160435.1.69105 WP_000160435.1.69110 WP_000160435.1.69111 WP_000160435.1.69120 WP_000160435.1.69125 WP_000160435.1.6915 WP_000160435.1.6917 WP_000160435.1.69179 WP_000160435.1.69191 WP_000160435.1.69198 WP_000160435.1.69213 WP_000160435.1.69219 WP_000160435.1.69222 WP_000160435.1.69232 WP_000160435.1.69237 WP_000160435.1.69239 WP_000160435.1.69251 WP_000160435.1.69280 WP_000160435.1.69314 WP_000160435.1.69349 WP_000160435.1.69361 WP_000160435.1.69366 WP_000160435.1.69378 WP_000160435.1.69394 WP_000160435.1.69395 WP_000160435.1.69415 WP_000160435.1.69434 WP_000160435.1.69437 WP_000160435.1.69446 WP_000160435.1.69475 WP_000160435.1.69476 WP_000160435.1.69477 WP_000160435.1.69480 WP_000160435.1.69484 WP_000160435.1.69490 WP_000160435.1.695 WP_000160435.1.6953 WP_000160435.1.69546 WP_000160435.1.69552 WP_000160435.1.69559 WP_000160435.1.69563 WP_000160435.1.69598 WP_000160435.1.69679 WP_000160435.1.6968 WP_000160435.1.69683 WP_000160435.1.69685 WP_000160435.1.69718 WP_000160435.1.69724 WP_000160435.1.69734 WP_000160435.1.6980 WP_000160435.1.69820 WP_000160435.1.69823 WP_000160435.1.69830 WP_000160435.1.69842 WP_000160435.1.69877 WP_000160435.1.69878 WP_000160435.1.69882 WP_000160435.1.699 WP_000160435.1.69902 WP_000160435.1.69921 WP_000160435.1.69934 WP_000160435.1.69980 WP_000160435.1.69987 WP_000160435.1.69995 WP_000160435.1.70024 WP_000160435.1.70048 WP_000160435.1.70059 WP_000160435.1.70089 WP_000160435.1.70105 WP_000160435.1.7012 WP_000160435.1.70133 WP_000160435.1.70161 WP_000160435.1.70210 WP_000160435.1.70220 WP_000160435.1.70225 WP_000160435.1.70228 WP_000160435.1.7024 WP_000160435.1.70253 WP_000160435.1.70273 WP_000160435.1.70294 WP_000160435.1.703 WP_000160435.1.7030 WP_000160435.1.70311 WP_000160435.1.70313 WP_000160435.1.70334 WP_000160435.1.70338 WP_000160435.1.7034 WP_000160435.1.70344 WP_000160435.1.70349 WP_000160435.1.70353 WP_000160435.1.70361 WP_000160435.1.70389 WP_000160435.1.70438 WP_000160435.1.70448 WP_000160435.1.70451 WP_000160435.1.70459 WP_000160435.1.7046 WP_000160435.1.70462 WP_000160435.1.70487 WP_000160435.1.70495 WP_000160435.1.70527 WP_000160435.1.7053 WP_000160435.1.70546 WP_000160435.1.70554 WP_000160435.1.70558 WP_000160435.1.70564 WP_000160435.1.70572 WP_000160435.1.7061 WP_000160435.1.70611 WP_000160435.1.70635 WP_000160435.1.7064 WP_000160435.1.70641 WP_000160435.1.70651 WP_000160435.1.70664 WP_000160435.1.707 WP_000160435.1.7071 WP_000160435.1.70721 WP_000160435.1.7073 WP_000160435.1.70763 WP_000160435.1.70790 WP_000160435.1.70791 WP_000160435.1.70807 WP_000160435.1.70808 WP_000160435.1.70818 WP_000160435.1.70823 WP_000160435.1.70829 WP_000160435.1.70835 WP_000160435.1.70843 WP_000160435.1.70855 WP_000160435.1.7089 WP_000160435.1.70909 WP_000160435.1.70917 WP_000160435.1.70924 WP_000160435.1.70926 WP_000160435.1.70930 WP_000160435.1.70939 WP_000160435.1.70943 WP_000160435.1.710 WP_000160435.1.71016 WP_000160435.1.71043 WP_000160435.1.7105 WP_000160435.1.71058 WP_000160435.1.71059 WP_000160435.1.71073 WP_000160435.1.7109 WP_000160435.1.711 WP_000160435.1.71130 WP_000160435.1.71143 WP_000160435.1.71180 WP_000160435.1.71182 WP_000160435.1.71196 WP_000160435.1.7120 WP_000160435.1.71208 WP_000160435.1.71231 WP_000160435.1.71236 WP_000160435.1.7125 WP_000160435.1.71256 WP_000160435.1.71257 WP_000160435.1.71267 WP_000160435.1.71295 WP_000160435.1.71313 WP_000160435.1.71325 WP_000160435.1.71332 WP_000160435.1.71345 WP_000160435.1.71351 WP_000160435.1.71359 WP_000160435.1.71410 WP_000160435.1.71416 WP_000160435.1.71419 WP_000160435.1.71431 WP_000160435.1.71463 WP_000160435.1.71466 WP_000160435.1.71467 WP_000160435.1.71475 WP_000160435.1.7150 WP_000160435.1.71519 WP_000160435.1.71521 WP_000160435.1.71529 WP_000160435.1.71543 WP_000160435.1.71572 WP_000160435.1.71575 WP_000160435.1.71596 WP_000160435.1.71602 WP_000160435.1.7161 WP_000160435.1.71644 WP_000160435.1.71662 WP_000160435.1.71676 WP_000160435.1.71715 WP_000160435.1.71721 WP_000160435.1.71735 WP_000160435.1.71737 WP_000160435.1.71739 WP_000160435.1.71741 WP_000160435.1.71772 WP_000160435.1.71780 WP_000160435.1.71788 WP_000160435.1.7179 WP_000160435.1.71859 WP_000160435.1.71861 WP_000160435.1.71863 WP_000160435.1.71877 WP_000160435.1.71888 WP_000160435.1.71892 WP_000160435.1.71899 WP_000160435.1.71910 WP_000160435.1.71925 WP_000160435.1.71949 WP_000160435.1.71978 WP_000160435.1.7198 WP_000160435.1.71989 WP_000160435.1.72002 WP_000160435.1.72018 WP_000160435.1.72026 WP_000160435.1.72031 WP_000160435.1.72035 WP_000160435.1.72067 WP_000160435.1.72085 WP_000160435.1.72089 WP_000160435.1.72099 WP_000160435.1.72112 WP_000160435.1.72148 WP_000160435.1.72169 WP_000160435.1.72176 WP_000160435.1.722 WP_000160435.1.72204 WP_000160435.1.72205 WP_000160435.1.72271 WP_000160435.1.72306 WP_000160435.1.72315 WP_000160435.1.72330 WP_000160435.1.72340 WP_000160435.1.72347 WP_000160435.1.7236 WP_000160435.1.72363 WP_000160435.1.72366 WP_000160435.1.72371 WP_000160435.1.7242 WP_000160435.1.72424 WP_000160435.1.72433 WP_000160435.1.72446 WP_000160435.1.72453 WP_000160435.1.72465 WP_000160435.1.72478 WP_000160435.1.72497 WP_000160435.1.7254 WP_000160435.1.72547 WP_000160435.1.72564 WP_000160435.1.7258 WP_000160435.1.7260 WP_000160435.1.72626 WP_000160435.1.72649 WP_000160435.1.72654 WP_000160435.1.72666 WP_000160435.1.72708 WP_000160435.1.72719 WP_000160435.1.72750 WP_000160435.1.72753 WP_000160435.1.72762 WP_000160435.1.7278 WP_000160435.1.72787 WP_000160435.1.72816 WP_000160435.1.72832 WP_000160435.1.72834 WP_000160435.1.72835 WP_000160435.1.72881 WP_000160435.1.72903 WP_000160435.1.72904 WP_000160435.1.7292 WP_000160435.1.72930 WP_000160435.1.72935 WP_000160435.1.72945 WP_000160435.1.72961 WP_000160435.1.72965 WP_000160435.1.72991 WP_000160435.1.73002 WP_000160435.1.73004 WP_000160435.1.73017 WP_000160435.1.73019 WP_000160435.1.73021 WP_000160435.1.73022 WP_000160435.1.73037 WP_000160435.1.73074 WP_000160435.1.73087 WP_000160435.1.73122 WP_000160435.1.73132 WP_000160435.1.73140 WP_000160435.1.73190 WP_000160435.1.73195 WP_000160435.1.73201 WP_000160435.1.73211 WP_000160435.1.73240 WP_000160435.1.73241 WP_000160435.1.73246 WP_000160435.1.73264 WP_000160435.1.73265 WP_000160435.1.73286 WP_000160435.1.73312 WP_000160435.1.73386 WP_000160435.1.73401 WP_000160435.1.73402 WP_000160435.1.73420 WP_000160435.1.73444 WP_000160435.1.73450 WP_000160435.1.73456 WP_000160435.1.73464 WP_000160435.1.73467 WP_000160435.1.73501 WP_000160435.1.73513 WP_000160435.1.73526 WP_000160435.1.73539 WP_000160435.1.73571 WP_000160435.1.73591 WP_000160435.1.736 WP_000160435.1.7360 WP_000160435.1.73610 WP_000160435.1.73639 WP_000160435.1.73640 WP_000160435.1.7365 WP_000160435.1.73674 WP_000160435.1.73685 WP_000160435.1.73693 WP_000160435.1.73694 WP_000160435.1.73733 WP_000160435.1.73735 WP_000160435.1.73736 WP_000160435.1.73740 WP_000160435.1.73759 WP_000160435.1.73786 WP_000160435.1.73789 WP_000160435.1.7380 WP_000160435.1.73834 WP_000160435.1.73858 WP_000160435.1.73868 WP_000160435.1.73880 WP_000160435.1.73885 WP_000160435.1.73900 WP_000160435.1.73902 WP_000160435.1.73910 WP_000160435.1.73920 WP_000160435.1.73921 WP_000160435.1.73940 WP_000160435.1.73949 WP_000160435.1.73961 WP_000160435.1.73969 WP_000160435.1.73971 WP_000160435.1.73976 WP_000160435.1.73983 WP_000160435.1.74004 WP_000160435.1.74006 WP_000160435.1.7401 WP_000160435.1.74010 WP_000160435.1.74013 WP_000160435.1.74027 WP_000160435.1.7406 WP_000160435.1.74073 WP_000160435.1.74081 WP_000160435.1.74085 WP_000160435.1.74088 WP_000160435.1.74155 WP_000160435.1.74157 WP_000160435.1.74158 WP_000160435.1.74161 WP_000160435.1.74173 WP_000160435.1.7418 WP_000160435.1.74183 WP_000160435.1.74187 WP_000160435.1.74201 WP_000160435.1.74216 WP_000160435.1.74234 WP_000160435.1.74237 WP_000160435.1.74242 WP_000160435.1.74257 WP_000160435.1.7427 WP_000160435.1.7428 WP_000160435.1.74284 WP_000160435.1.74295 WP_000160435.1.74327 WP_000160435.1.74338 WP_000160435.1.7434 WP_000160435.1.74353 WP_000160435.1.74356 WP_000160435.1.74380 WP_000160435.1.74429 WP_000160435.1.74456 WP_000160435.1.74457 WP_000160435.1.74468 WP_000160435.1.74474 WP_000160435.1.74486 WP_000160435.1.74533 WP_000160435.1.74556 WP_000160435.1.7457 WP_000160435.1.74576 WP_000160435.1.74587 WP_000160435.1.74610 WP_000160435.1.74638 WP_000160435.1.74645 WP_000160435.1.74676 WP_000160435.1.74681 WP_000160435.1.74693 WP_000160435.1.74696 WP_000160435.1.74731 WP_000160435.1.74747 WP_000160435.1.74758 WP_000160435.1.74761 WP_000160435.1.74770 WP_000160435.1.74781 WP_000160435.1.74785 WP_000160435.1.74797 WP_000160435.1.74802 WP_000160435.1.7482 WP_000160435.1.74846 WP_000160435.1.74849 WP_000160435.1.74866 WP_000160435.1.74874 WP_000160435.1.74890 WP_000160435.1.74899 WP_000160435.1.74911 WP_000160435.1.74922 WP_000160435.1.74961 WP_000160435.1.74963 WP_000160435.1.74978 WP_000160435.1.74994 WP_000160435.1.74999 WP_000160435.1.7500 WP_000160435.1.75006 WP_000160435.1.75038 WP_000160435.1.75044 WP_000160435.1.75048 WP_000160435.1.75052 WP_000160435.1.75070 WP_000160435.1.75091 WP_000160435.1.75093 WP_000160435.1.75111 WP_000160435.1.75122 WP_000160435.1.75131 WP_000160435.1.75132 WP_000160435.1.75141 WP_000160435.1.75186 WP_000160435.1.75227 WP_000160435.1.75253 WP_000160435.1.75294 WP_000160435.1.75298 WP_000160435.1.75320 WP_000160435.1.75323 WP_000160435.1.75327 WP_000160435.1.75349 WP_000160435.1.75351 WP_000160435.1.75356 WP_000160435.1.75365 WP_000160435.1.75369 WP_000160435.1.75375 WP_000160435.1.75379 WP_000160435.1.75399 WP_000160435.1.75409 WP_000160435.1.75411 WP_000160435.1.7542 WP_000160435.1.75438 WP_000160435.1.75440 WP_000160435.1.75481 WP_000160435.1.75506 WP_000160435.1.75509 WP_000160435.1.75527 WP_000160435.1.75538 WP_000160435.1.75542 WP_000160435.1.75551 WP_000160435.1.75566 WP_000160435.1.75571 WP_000160435.1.7561 WP_000160435.1.75623 WP_000160435.1.75647 WP_000160435.1.75649 WP_000160435.1.75652 WP_000160435.1.75680 WP_000160435.1.75685 WP_000160435.1.75692 WP_000160435.1.75728 WP_000160435.1.75743 WP_000160435.1.75769 WP_000160435.1.75770 WP_000160435.1.75775 WP_000160435.1.758 WP_000160435.1.75800 WP_000160435.1.75809 WP_000160435.1.75824 WP_000160435.1.75830 WP_000160435.1.7584 WP_000160435.1.75840 WP_000160435.1.75848 WP_000160435.1.75851 WP_000160435.1.75856 WP_000160435.1.75862 WP_000160435.1.75879 WP_000160435.1.75881 WP_000160435.1.75885 WP_000160435.1.75910 WP_000160435.1.75929 WP_000160435.1.75952 WP_000160435.1.75956 WP_000160435.1.7596 WP_000160435.1.75969 WP_000160435.1.76010 WP_000160435.1.76013 WP_000160435.1.76015 WP_000160435.1.7602 WP_000160435.1.76047 WP_000160435.1.76049 WP_000160435.1.76053 WP_000160435.1.7607 WP_000160435.1.76071 WP_000160435.1.76073 WP_000160435.1.76095 WP_000160435.1.76111 WP_000160435.1.76112 WP_000160435.1.76114 WP_000160435.1.76121 WP_000160435.1.76136 WP_000160435.1.76143 WP_000160435.1.76149 WP_000160435.1.76153 WP_000160435.1.76179 WP_000160435.1.76185 WP_000160435.1.76230 WP_000160435.1.76234 WP_000160435.1.7624 WP_000160435.1.7625 WP_000160435.1.76258 WP_000160435.1.76261 WP_000160435.1.7627 WP_000160435.1.76282 WP_000160435.1.76283 WP_000160435.1.76294 WP_000160435.1.76313 WP_000160435.1.76323 WP_000160435.1.76332 WP_000160435.1.76333 WP_000160435.1.76337 WP_000160435.1.76351 WP_000160435.1.7638 WP_000160435.1.76419 WP_000160435.1.76420 WP_000160435.1.76421 WP_000160435.1.76424 WP_000160435.1.76426 WP_000160435.1.76431 WP_000160435.1.76463 WP_000160435.1.76482 WP_000160435.1.76497 WP_000160435.1.765 WP_000160435.1.76528 WP_000160435.1.7658 WP_000160435.1.76604 WP_000160435.1.76606 WP_000160435.1.76624 WP_000160435.1.76648 WP_000160435.1.76674 WP_000160435.1.76686 WP_000160435.1.76690 WP_000160435.1.76693 WP_000160435.1.76711 WP_000160435.1.76718 WP_000160435.1.7675 WP_000160435.1.76790 WP_000160435.1.76792 WP_000160435.1.76798 WP_000160435.1.768 WP_000160435.1.76803 WP_000160435.1.76816 WP_000160435.1.76820 WP_000160435.1.76825 WP_000160435.1.76829 WP_000160435.1.76839 WP_000160435.1.76845 WP_000160435.1.7686 WP_000160435.1.76867 WP_000160435.1.76878 WP_000160435.1.76897 WP_000160435.1.76920 WP_000160435.1.76921 WP_000160435.1.76937 WP_000160435.1.7694 WP_000160435.1.76944 WP_000160435.1.76952 WP_000160435.1.76998 WP_000160435.1.77020 WP_000160435.1.77027 WP_000160435.1.77031 WP_000160435.1.77041 WP_000160435.1.77043 WP_000160435.1.77050 WP_000160435.1.77060 WP_000160435.1.77062 WP_000160435.1.77072 WP_000160435.1.77112 WP_000160435.1.77137 WP_000160435.1.77145 WP_000160435.1.77158 WP_000160435.1.77176 WP_000160435.1.77183 WP_000160435.1.77187 WP_000160435.1.77190 WP_000160435.1.77203 WP_000160435.1.77229 WP_000160435.1.77256 WP_000160435.1.77259 WP_000160435.1.77297 WP_000160435.1.77298 WP_000160435.1.77305 WP_000160435.1.77331 WP_000160435.1.77346 WP_000160435.1.77354 WP_000160435.1.77359 WP_000160435.1.77388 WP_000160435.1.77416 WP_000160435.1.77426 WP_000160435.1.77446 WP_000160435.1.7745 WP_000160435.1.7746 WP_000160435.1.77460 WP_000160435.1.77485 WP_000160435.1.77497 WP_000160435.1.77498 WP_000160435.1.77527 WP_000160435.1.77532 WP_000160435.1.77533 WP_000160435.1.77536 WP_000160435.1.77572 WP_000160435.1.77603 WP_000160435.1.77606 WP_000160435.1.77650 WP_000160435.1.77674 WP_000160435.1.77735 WP_000160435.1.77738 WP_000160435.1.7774 WP_000160435.1.77743 WP_000160435.1.77745 WP_000160435.1.77763 WP_000160435.1.77791 WP_000160435.1.77805 WP_000160435.1.77814 WP_000160435.1.77818 WP_000160435.1.77822 WP_000160435.1.77827 WP_000160435.1.77832 WP_000160435.1.77848 WP_000160435.1.7785 WP_000160435.1.77858 WP_000160435.1.7786 WP_000160435.1.7787 WP_000160435.1.77882 WP_000160435.1.77893 WP_000160435.1.77896 WP_000160435.1.77908 WP_000160435.1.77915 WP_000160435.1.77922 WP_000160435.1.77930 WP_000160435.1.77952 WP_000160435.1.77957 WP_000160435.1.77986 WP_000160435.1.78002 WP_000160435.1.78038 WP_000160435.1.78050 WP_000160435.1.78054 WP_000160435.1.78082 WP_000160435.1.78091 WP_000160435.1.78093 WP_000160435.1.78095 WP_000160435.1.7810 WP_000160435.1.78126 WP_000160435.1.78164 WP_000160435.1.78173 WP_000160435.1.78179 WP_000160435.1.78185 WP_000160435.1.78189 WP_000160435.1.78194 WP_000160435.1.78207 WP_000160435.1.78208 WP_000160435.1.78252 WP_000160435.1.78254 WP_000160435.1.78257 WP_000160435.1.7827 WP_000160435.1.78304 WP_000160435.1.78311 WP_000160435.1.7833 WP_000160435.1.78330 WP_000160435.1.78332 WP_000160435.1.78335 WP_000160435.1.78365 WP_000160435.1.78371 WP_000160435.1.78392 WP_000160435.1.78404 WP_000160435.1.78434 WP_000160435.1.78436 WP_000160435.1.78458 WP_000160435.1.78470 WP_000160435.1.78489 WP_000160435.1.78494 WP_000160435.1.7850 WP_000160435.1.78513 WP_000160435.1.7853 WP_000160435.1.78550 WP_000160435.1.78558 WP_000160435.1.7857 WP_000160435.1.78573 WP_000160435.1.78582 WP_000160435.1.78585 WP_000160435.1.78592 WP_000160435.1.78596 WP_000160435.1.78598 WP_000160435.1.78604 WP_000160435.1.78625 WP_000160435.1.78633 WP_000160435.1.78653 WP_000160435.1.78662 WP_000160435.1.78667 WP_000160435.1.78685 WP_000160435.1.78708 WP_000160435.1.78728 WP_000160435.1.78731 WP_000160435.1.78736 WP_000160435.1.78758 WP_000160435.1.78763 WP_000160435.1.78785 WP_000160435.1.78803 WP_000160435.1.78816 WP_000160435.1.78819 WP_000160435.1.78841 WP_000160435.1.78872 WP_000160435.1.7888 WP_000160435.1.78897 WP_000160435.1.78920 WP_000160435.1.78934 WP_000160435.1.78937 WP_000160435.1.78946 WP_000160435.1.78983 WP_000160435.1.78985 WP_000160435.1.78991 WP_000160435.1.78995 WP_000160435.1.7900 WP_000160435.1.79006 WP_000160435.1.79037 WP_000160435.1.79038 WP_000160435.1.7905 WP_000160435.1.79051 WP_000160435.1.79085 WP_000160435.1.79110 WP_000160435.1.79114 WP_000160435.1.79131 WP_000160435.1.7914 WP_000160435.1.79143 WP_000160435.1.79178 WP_000160435.1.79192 WP_000160435.1.79197 WP_000160435.1.79208 WP_000160435.1.79223 WP_000160435.1.79227 WP_000160435.1.79244 WP_000160435.1.79270 WP_000160435.1.79275 WP_000160435.1.79285 WP_000160435.1.7931 WP_000160435.1.79310 WP_000160435.1.79314 WP_000160435.1.79320 WP_000160435.1.79322 WP_000160435.1.79332 WP_000160435.1.79334 WP_000160435.1.79341 WP_000160435.1.79367 WP_000160435.1.79374 WP_000160435.1.79378 WP_000160435.1.79379 WP_000160435.1.79402 WP_000160435.1.79408 WP_000160435.1.79436 WP_000160435.1.79461 WP_000160435.1.79473 WP_000160435.1.79476 WP_000160435.1.79487 WP_000160435.1.79539 WP_000160435.1.79543 WP_000160435.1.79552 WP_000160435.1.79556 WP_000160435.1.79581 WP_000160435.1.79626 WP_000160435.1.79627 WP_000160435.1.79646 WP_000160435.1.79662 WP_000160435.1.79664 WP_000160435.1.79672 WP_000160435.1.79676 WP_000160435.1.79677 WP_000160435.1.79706 WP_000160435.1.79731 WP_000160435.1.79763 WP_000160435.1.7981 WP_000160435.1.79810 WP_000160435.1.79815 WP_000160435.1.79822 WP_000160435.1.79831 WP_000160435.1.79834 WP_000160435.1.79837 WP_000160435.1.79855 WP_000160435.1.7989 WP_000160435.1.79896 WP_000160435.1.79904 WP_000160435.1.79911 WP_000160435.1.79919 WP_000160435.1.7992 WP_000160435.1.79941 WP_000160435.1.79961 WP_000160435.1.79971 WP_000160435.1.79991 WP_000160435.1.80000 WP_000160435.1.80009 WP_000160435.1.80013 WP_000160435.1.80029 WP_000160435.1.80032 WP_000160435.1.80034 WP_000160435.1.80042 WP_000160435.1.80079 WP_000160435.1.80086 WP_000160435.1.80109 WP_000160435.1.80119 WP_000160435.1.80120 WP_000160435.1.80122 WP_000160435.1.80124 WP_000160435.1.80127 WP_000160435.1.80146 WP_000160435.1.80147 WP_000160435.1.80159 WP_000160435.1.80178 WP_000160435.1.80184 WP_000160435.1.80203 WP_000160435.1.80206 WP_000160435.1.80210 WP_000160435.1.80244 WP_000160435.1.80274 WP_000160435.1.80287 WP_000160435.1.80290 WP_000160435.1.80297 WP_000160435.1.80303 WP_000160435.1.8031 WP_000160435.1.80316 WP_000160435.1.80318 WP_000160435.1.8035 WP_000160435.1.80358 WP_000160435.1.80361 WP_000160435.1.80378 WP_000160435.1.80389 WP_000160435.1.8040 WP_000160435.1.80407 WP_000160435.1.80414 WP_000160435.1.8043 WP_000160435.1.80434 WP_000160435.1.8045 WP_000160435.1.80472 WP_000160435.1.80482 WP_000160435.1.80521 WP_000160435.1.80530 WP_000160435.1.80582 WP_000160435.1.8065 WP_000160435.1.80653 WP_000160435.1.8066 WP_000160435.1.80680 WP_000160435.1.80687 WP_000160435.1.80717 WP_000160435.1.80734 WP_000160435.1.80745 WP_000160435.1.80761 WP_000160435.1.80763 WP_000160435.1.80781 WP_000160435.1.80786 WP_000160435.1.80793 WP_000160435.1.80801 WP_000160435.1.80828 WP_000160435.1.80833 WP_000160435.1.8084 WP_000160435.1.8085 WP_000160435.1.80855 WP_000160435.1.80872 WP_000160435.1.80899 WP_000160435.1.809 WP_000160435.1.80962 WP_000160435.1.80979 WP_000160435.1.80980 WP_000160435.1.81010 WP_000160435.1.81022 WP_000160435.1.81049 WP_000160435.1.81052 WP_000160435.1.81055 WP_000160435.1.81064 WP_000160435.1.81065 WP_000160435.1.81085 WP_000160435.1.81092 WP_000160435.1.81095 WP_000160435.1.81097 WP_000160435.1.81114 WP_000160435.1.81132 WP_000160435.1.81151 WP_000160435.1.81157 WP_000160435.1.81171 WP_000160435.1.81172 WP_000160435.1.81176 WP_000160435.1.81184 WP_000160435.1.81214 WP_000160435.1.81228 WP_000160435.1.81232 WP_000160435.1.81234 WP_000160435.1.8125 WP_000160435.1.81252 WP_000160435.1.81288 WP_000160435.1.81290 WP_000160435.1.81344 WP_000160435.1.8135 WP_000160435.1.81379 WP_000160435.1.81384 WP_000160435.1.81385 WP_000160435.1.81389 WP_000160435.1.8142 WP_000160435.1.81436 WP_000160435.1.8144 WP_000160435.1.81464 WP_000160435.1.81467 WP_000160435.1.81508 WP_000160435.1.81549 WP_000160435.1.81572 WP_000160435.1.81574 WP_000160435.1.81599 WP_000160435.1.81604 WP_000160435.1.81610 WP_000160435.1.81619 WP_000160435.1.81631 WP_000160435.1.81637 WP_000160435.1.81645 WP_000160435.1.81718 WP_000160435.1.81734 WP_000160435.1.81740 WP_000160435.1.81758 WP_000160435.1.8176 WP_000160435.1.81767 WP_000160435.1.8180 WP_000160435.1.81800 WP_000160435.1.81810 WP_000160435.1.81812 WP_000160435.1.81831 WP_000160435.1.81837 WP_000160435.1.81838 WP_000160435.1.8185 WP_000160435.1.81861 WP_000160435.1.81870 WP_000160435.1.8188 WP_000160435.1.81897 WP_000160435.1.81903 WP_000160435.1.81904 WP_000160435.1.81905 WP_000160435.1.81906 WP_000160435.1.81919 WP_000160435.1.81940 WP_000160435.1.81944 WP_000160435.1.81955 WP_000160435.1.81969 WP_000160435.1.81990 WP_000160435.1.81996 WP_000160435.1.81999 WP_000160435.1.82009 WP_000160435.1.82015 WP_000160435.1.82053 WP_000160435.1.8206 WP_000160435.1.82091 WP_000160435.1.82103 WP_000160435.1.8212 WP_000160435.1.82121 WP_000160435.1.8213 WP_000160435.1.82161 WP_000160435.1.82167 WP_000160435.1.82174 WP_000160435.1.82184 WP_000160435.1.82219 WP_000160435.1.82247 WP_000160435.1.82253 WP_000160435.1.82259 WP_000160435.1.82278 WP_000160435.1.82281 WP_000160435.1.82301 WP_000160435.1.82340 WP_000160435.1.82349 WP_000160435.1.82354 WP_000160435.1.82358 WP_000160435.1.82368 WP_000160435.1.82406 WP_000160435.1.82441 WP_000160435.1.82447 WP_000160435.1.82458 WP_000160435.1.8246 WP_000160435.1.82467 WP_000160435.1.82468 WP_000160435.1.82525 WP_000160435.1.82535 WP_000160435.1.82548 WP_000160435.1.82558 WP_000160435.1.82612 WP_000160435.1.8265 WP_000160435.1.8266 WP_000160435.1.82678 WP_000160435.1.82709 WP_000160435.1.82724 WP_000160435.1.82760 WP_000160435.1.82762 WP_000160435.1.82768 WP_000160435.1.82775 WP_000160435.1.82796 WP_000160435.1.8280 WP_000160435.1.82802 WP_000160435.1.82824 WP_000160435.1.82829 WP_000160435.1.82835 WP_000160435.1.82855 WP_000160435.1.82862 WP_000160435.1.8289 WP_000160435.1.82916 WP_000160435.1.82930 WP_000160435.1.82931 WP_000160435.1.82941 WP_000160435.1.82976 WP_000160435.1.82980 WP_000160435.1.82984 WP_000160435.1.82997 WP_000160435.1.83011 WP_000160435.1.83013 WP_000160435.1.83046 WP_000160435.1.83050 WP_000160435.1.83053 WP_000160435.1.83054 WP_000160435.1.83078 WP_000160435.1.83086 WP_000160435.1.83088 WP_000160435.1.8310 WP_000160435.1.83103 WP_000160435.1.83152 WP_000160435.1.83153 WP_000160435.1.8318 WP_000160435.1.83185 WP_000160435.1.83193 WP_000160435.1.83203 WP_000160435.1.83234 WP_000160435.1.83243 WP_000160435.1.8328 WP_000160435.1.83291 WP_000160435.1.83316 WP_000160435.1.83352 WP_000160435.1.83359 WP_000160435.1.83372 WP_000160435.1.83405 WP_000160435.1.83416 WP_000160435.1.83417 WP_000160435.1.8346 WP_000160435.1.83467 WP_000160435.1.83468 WP_000160435.1.83472 WP_000160435.1.83475 WP_000160435.1.83476 WP_000160435.1.83479 WP_000160435.1.83484 WP_000160435.1.83508 WP_000160435.1.83517 WP_000160435.1.83520 WP_000160435.1.83553 WP_000160435.1.83592 WP_000160435.1.83593 WP_000160435.1.83624 WP_000160435.1.83626 WP_000160435.1.83645 WP_000160435.1.83646 WP_000160435.1.83652 WP_000160435.1.83653 WP_000160435.1.8366 WP_000160435.1.83674 WP_000160435.1.83676 WP_000160435.1.83714 WP_000160435.1.83720 WP_000160435.1.83728 WP_000160435.1.83750 WP_000160435.1.83756 WP_000160435.1.83758 WP_000160435.1.83763 WP_000160435.1.83769 WP_000160435.1.83770 WP_000160435.1.83775 WP_000160435.1.83778 WP_000160435.1.83788 WP_000160435.1.83797 WP_000160435.1.83804 WP_000160435.1.83825 WP_000160435.1.8383 WP_000160435.1.83837 WP_000160435.1.83844 WP_000160435.1.8385 WP_000160435.1.83852 WP_000160435.1.83864 WP_000160435.1.83865 WP_000160435.1.83868 WP_000160435.1.83881 WP_000160435.1.83886 WP_000160435.1.83902 WP_000160435.1.83912 WP_000160435.1.83919 WP_000160435.1.83925 WP_000160435.1.83928 WP_000160435.1.83935 WP_000160435.1.83955 WP_000160435.1.83984 WP_000160435.1.83989 WP_000160435.1.84010 WP_000160435.1.84025 WP_000160435.1.84041 WP_000160435.1.84049 WP_000160435.1.84054 WP_000160435.1.84064 WP_000160435.1.84067 WP_000160435.1.84068 WP_000160435.1.84118 WP_000160435.1.84129 WP_000160435.1.84144 WP_000160435.1.84161 WP_000160435.1.84163 WP_000160435.1.84188 WP_000160435.1.84275 WP_000160435.1.84284 WP_000160435.1.84293 WP_000160435.1.84322 WP_000160435.1.84342 WP_000160435.1.84414 WP_000160435.1.84415 WP_000160435.1.84416 WP_000160435.1.84418 WP_000160435.1.84442 WP_000160435.1.84445 WP_000160435.1.84451 WP_000160435.1.84509 WP_000160435.1.84555 WP_000160435.1.84563 WP_000160435.1.84570 WP_000160435.1.84590 WP_000160435.1.84596 WP_000160435.1.84602 WP_000160435.1.84608 WP_000160435.1.84612 WP_000160435.1.8462 WP_000160435.1.84625 WP_000160435.1.84630 WP_000160435.1.84638 WP_000160435.1.84648 WP_000160435.1.84651 WP_000160435.1.84652 WP_000160435.1.84662 WP_000160435.1.8468 WP_000160435.1.84682 WP_000160435.1.84696 WP_000160435.1.8475 WP_000160435.1.84752 WP_000160435.1.84757 WP_000160435.1.84761 WP_000160435.1.84815 WP_000160435.1.84826 WP_000160435.1.84844 WP_000160435.1.84847 WP_000160435.1.84854 WP_000160435.1.84889 WP_000160435.1.84903 WP_000160435.1.84907 WP_000160435.1.84922 WP_000160435.1.84924 WP_000160435.1.8493 WP_000160435.1.84943 WP_000160435.1.8496 WP_000160435.1.84975 WP_000160435.1.84978 WP_000160435.1.85017 WP_000160435.1.85022 WP_000160435.1.85026 WP_000160435.1.85045 WP_000160435.1.85047 WP_000160435.1.85056 WP_000160435.1.85070 WP_000160435.1.85081 WP_000160435.1.85083 WP_000160435.1.85099 WP_000160435.1.851 WP_000160435.1.85113 WP_000160435.1.85118 WP_000160435.1.85132 WP_000160435.1.85135 WP_000160435.1.85144 WP_000160435.1.85151 WP_000160435.1.85160 WP_000160435.1.85213 WP_000160435.1.85224 WP_000160435.1.85226 WP_000160435.1.85229 WP_000160435.1.85231 WP_000160435.1.85235 WP_000160435.1.85238 WP_000160435.1.85289 WP_000160435.1.85292 WP_000160435.1.85294 WP_000160435.1.85297 WP_000160435.1.85302 WP_000160435.1.85351 WP_000160435.1.85374 WP_000160435.1.85375 WP_000160435.1.85376 WP_000160435.1.85383 WP_000160435.1.85395 WP_000160435.1.85404 WP_000160435.1.85409 WP_000160435.1.85440 WP_000160435.1.85441 WP_000160435.1.85445 WP_000160435.1.85455 WP_000160435.1.85462 WP_000160435.1.85471 WP_000160435.1.85474 WP_000160435.1.85485 WP_000160435.1.85492 WP_000160435.1.85506 WP_000160435.1.8551 WP_000160435.1.85515 WP_000160435.1.85519 WP_000160435.1.85542 WP_000160435.1.85547 WP_000160435.1.85555 WP_000160435.1.85585 WP_000160435.1.85586 WP_000160435.1.85596 WP_000160435.1.85607 WP_000160435.1.85611 WP_000160435.1.85649 WP_000160435.1.85678 WP_000160435.1.85705 WP_000160435.1.8572 WP_000160435.1.85730 WP_000160435.1.85732 WP_000160435.1.85758 WP_000160435.1.85795 WP_000160435.1.85796 WP_000160435.1.85809 WP_000160435.1.85816 WP_000160435.1.85834 WP_000160435.1.85844 WP_000160435.1.85858 WP_000160435.1.85873 WP_000160435.1.85906 WP_000160435.1.85924 WP_000160435.1.85927 WP_000160435.1.85950 WP_000160435.1.85971 WP_000160435.1.85980 WP_000160435.1.85993 WP_000160435.1.86018 WP_000160435.1.86036 WP_000160435.1.86042 WP_000160435.1.86072 WP_000160435.1.86086 WP_000160435.1.8609 WP_000160435.1.86101 WP_000160435.1.86106 WP_000160435.1.86123 WP_000160435.1.86144 WP_000160435.1.86158 WP_000160435.1.8617 WP_000160435.1.86178 WP_000160435.1.86188 WP_000160435.1.862 WP_000160435.1.86207 WP_000160435.1.86209 WP_000160435.1.86248 WP_000160435.1.86256 WP_000160435.1.8627 WP_000160435.1.86270 WP_000160435.1.86281 WP_000160435.1.86304 WP_000160435.1.86315 WP_000160435.1.86344 WP_000160435.1.8636 WP_000160435.1.86363 WP_000160435.1.86367 WP_000160435.1.86378 WP_000160435.1.86390 WP_000160435.1.8643 WP_000160435.1.86439 WP_000160435.1.86473 WP_000160435.1.86482 WP_000160435.1.86505 WP_000160435.1.86508 WP_000160435.1.86523 WP_000160435.1.86531 WP_000160435.1.86542 WP_000160435.1.86606 WP_000160435.1.86628 WP_000160435.1.86629 WP_000160435.1.86664 WP_000160435.1.86704 WP_000160435.1.86706 WP_000160435.1.86736 WP_000160435.1.86745 WP_000160435.1.86754 WP_000160435.1.86779 WP_000160435.1.86792 WP_000160435.1.86793 WP_000160435.1.86795 WP_000160435.1.8681 WP_000160435.1.86838 WP_000160435.1.8690 WP_000160435.1.86910 WP_000160435.1.86911 WP_000160435.1.86942 WP_000160435.1.86955 WP_000160435.1.86961 WP_000160435.1.86968 WP_000160435.1.86977 WP_000160435.1.86999 WP_000160435.1.87021 WP_000160435.1.87022 WP_000160435.1.87042 WP_000160435.1.87057 WP_000160435.1.87072 WP_000160435.1.87088 WP_000160435.1.87090 WP_000160435.1.87097 WP_000160435.1.87100 WP_000160435.1.87119 WP_000160435.1.8712 WP_000160435.1.87122 WP_000160435.1.87141 WP_000160435.1.87168 WP_000160435.1.87175 WP_000160435.1.87190 WP_000160435.1.87194 WP_000160435.1.8720 WP_000160435.1.87204 WP_000160435.1.87221 WP_000160435.1.87250 WP_000160435.1.87260 WP_000160435.1.87261 WP_000160435.1.87263 WP_000160435.1.87272 WP_000160435.1.87285 WP_000160435.1.87290 WP_000160435.1.87296 WP_000160435.1.8731 WP_000160435.1.87363 WP_000160435.1.87372 WP_000160435.1.87378 WP_000160435.1.87388 WP_000160435.1.87391 WP_000160435.1.87396 WP_000160435.1.87397 WP_000160435.1.87425 WP_000160435.1.87434 WP_000160435.1.87457 WP_000160435.1.87461 WP_000160435.1.87466 WP_000160435.1.87475 WP_000160435.1.87486 WP_000160435.1.87498 WP_000160435.1.875 WP_000160435.1.87502 WP_000160435.1.87508 WP_000160435.1.87511 WP_000160435.1.87515 WP_000160435.1.87541 WP_000160435.1.87543 WP_000160435.1.87595 WP_000160435.1.87601 WP_000160435.1.87623 WP_000160435.1.8764 WP_000160435.1.87703 WP_000160435.1.87710 WP_000160435.1.87718 WP_000160435.1.87734 WP_000160435.1.87745 WP_000160435.1.87748 WP_000160435.1.87764 WP_000160435.1.87782 WP_000160435.1.8779 WP_000160435.1.87802 WP_000160435.1.87808 WP_000160435.1.87828 WP_000160435.1.87841 WP_000160435.1.87843 WP_000160435.1.87854 WP_000160435.1.87865 WP_000160435.1.87879 WP_000160435.1.8791 WP_000160435.1.87912 WP_000160435.1.87937 WP_000160435.1.87943 WP_000160435.1.87948 WP_000160435.1.87963 WP_000160435.1.87964 WP_000160435.1.87967 WP_000160435.1.87972 WP_000160435.1.87995 WP_000160435.1.88013 WP_000160435.1.88032 WP_000160435.1.88061 WP_000160435.1.88114 WP_000160435.1.88150 WP_000160435.1.88166 WP_000160435.1.88169 WP_000160435.1.8820 WP_000160435.1.88240 WP_000160435.1.88270 WP_000160435.1.88279 WP_000160435.1.88309 WP_000160435.1.88311 WP_000160435.1.88317 WP_000160435.1.88319 WP_000160435.1.88328 WP_000160435.1.88348 WP_000160435.1.88351 WP_000160435.1.88367 WP_000160435.1.88371 WP_000160435.1.88373 WP_000160435.1.88375 WP_000160435.1.88380 WP_000160435.1.88395 WP_000160435.1.88418 WP_000160435.1.88430 WP_000160435.1.88440 WP_000160435.1.8847 WP_000160435.1.88471 WP_000160435.1.88473 WP_000160435.1.88480 WP_000160435.1.88490 WP_000160435.1.88498 WP_000160435.1.88518 WP_000160435.1.88536 WP_000160435.1.88555 WP_000160435.1.88558 WP_000160435.1.88560 WP_000160435.1.88563 WP_000160435.1.8857 WP_000160435.1.88580 WP_000160435.1.88583 WP_000160435.1.88585 WP_000160435.1.8859 WP_000160435.1.88599 WP_000160435.1.88600 WP_000160435.1.88614 WP_000160435.1.88623 WP_000160435.1.88636 WP_000160435.1.88642 WP_000160435.1.88671 WP_000160435.1.88694 WP_000160435.1.88696 WP_000160435.1.8872 WP_000160435.1.88739 WP_000160435.1.88753 WP_000160435.1.88761 WP_000160435.1.88771 WP_000160435.1.88781 WP_000160435.1.88827 WP_000160435.1.88843 WP_000160435.1.88856 WP_000160435.1.88859 WP_000160435.1.88861 WP_000160435.1.88871 WP_000160435.1.88874 WP_000160435.1.88878 WP_000160435.1.8888 WP_000160435.1.88897 WP_000160435.1.88912 WP_000160435.1.88922 WP_000160435.1.88934 WP_000160435.1.88954 WP_000160435.1.88960 WP_000160435.1.88962 WP_000160435.1.88987 WP_000160435.1.8899 WP_000160435.1.8900 WP_000160435.1.89012 WP_000160435.1.89024 WP_000160435.1.89036 WP_000160435.1.89070 WP_000160435.1.89086 WP_000160435.1.89103 WP_000160435.1.89125 WP_000160435.1.8913 WP_000160435.1.89133 WP_000160435.1.89164 WP_000160435.1.89173 WP_000160435.1.8918 WP_000160435.1.89181 WP_000160435.1.89184 WP_000160435.1.89194 WP_000160435.1.89195 WP_000160435.1.89204 WP_000160435.1.89229 WP_000160435.1.89235 WP_000160435.1.89237 WP_000160435.1.8924 WP_000160435.1.89258 WP_000160435.1.89262 WP_000160435.1.89284 WP_000160435.1.8929 WP_000160435.1.89290 WP_000160435.1.89347 WP_000160435.1.89348 WP_000160435.1.89350 WP_000160435.1.89390 WP_000160435.1.89404 WP_000160435.1.89414 WP_000160435.1.89433 WP_000160435.1.89516 WP_000160435.1.8953 WP_000160435.1.89537 WP_000160435.1.89544 WP_000160435.1.89545 WP_000160435.1.89559 WP_000160435.1.89594 WP_000160435.1.89628 WP_000160435.1.89651 WP_000160435.1.89655 WP_000160435.1.89672 WP_000160435.1.89678 WP_000160435.1.89715 WP_000160435.1.89726 WP_000160435.1.89730 WP_000160435.1.89738 WP_000160435.1.89754 WP_000160435.1.89779 WP_000160435.1.89794 WP_000160435.1.898 WP_000160435.1.89857 WP_000160435.1.8986 WP_000160435.1.89860 WP_000160435.1.89863 WP_000160435.1.89883 WP_000160435.1.89908 WP_000160435.1.89933 WP_000160435.1.89935 WP_000160435.1.89949 WP_000160435.1.89950 WP_000160435.1.89960 WP_000160435.1.90005 WP_000160435.1.90018 WP_000160435.1.90038 WP_000160435.1.90046 WP_000160435.1.90055 WP_000160435.1.90069 WP_000160435.1.90091 WP_000160435.1.90112 WP_000160435.1.90131 WP_000160435.1.90148 WP_000160435.1.90161 WP_000160435.1.90173 WP_000160435.1.90174 WP_000160435.1.90180 WP_000160435.1.90215 WP_000160435.1.90217 WP_000160435.1.9022 WP_000160435.1.90232 WP_000160435.1.90243 WP_000160435.1.90244 WP_000160435.1.90246 WP_000160435.1.90250 WP_000160435.1.90253 WP_000160435.1.90276 WP_000160435.1.9030 WP_000160435.1.90307 WP_000160435.1.90331 WP_000160435.1.90367 WP_000160435.1.90386 WP_000160435.1.90432 WP_000160435.1.90447 WP_000160435.1.90454 WP_000160435.1.90473 WP_000160435.1.90475 WP_000160435.1.90488 WP_000160435.1.90506 WP_000160435.1.90517 WP_000160435.1.90533 WP_000160435.1.90544 WP_000160435.1.90548 WP_000160435.1.9055 WP_000160435.1.90554 WP_000160435.1.90556 WP_000160435.1.90562 WP_000160435.1.90604 WP_000160435.1.90647 WP_000160435.1.90660 WP_000160435.1.90661 WP_000160435.1.90683 WP_000160435.1.90698 WP_000160435.1.9071 WP_000160435.1.90717 WP_000160435.1.90726 WP_000160435.1.90728 WP_000160435.1.90738 WP_000160435.1.9074 WP_000160435.1.90745 WP_000160435.1.9076 WP_000160435.1.90777 WP_000160435.1.90801 WP_000160435.1.90804 WP_000160435.1.90861 WP_000160435.1.90875 WP_000160435.1.90887 WP_000160435.1.90896 WP_000160435.1.90903 WP_000160435.1.90923 WP_000160435.1.90928 WP_000160435.1.9100 WP_000160435.1.91005 WP_000160435.1.91011 WP_000160435.1.91019 WP_000160435.1.91054 WP_000160435.1.91089 WP_000160435.1.91124 WP_000160435.1.91126 WP_000160435.1.9114 WP_000160435.1.91150 WP_000160435.1.91158 WP_000160435.1.91177 WP_000160435.1.912 WP_000160435.1.9122 WP_000160435.1.91233 WP_000160435.1.91246 WP_000160435.1.91258 WP_000160435.1.9127 WP_000160435.1.91279 WP_000160435.1.91280 WP_000160435.1.91287 WP_000160435.1.91300 WP_000160435.1.91310 WP_000160435.1.91316 WP_000160435.1.91332 WP_000160435.1.91346 WP_000160435.1.91357 WP_000160435.1.91364 WP_000160435.1.91365 WP_000160435.1.91371 WP_000160435.1.91380 WP_000160435.1.91382 WP_000160435.1.9140 WP_000160435.1.91420 WP_000160435.1.91427 WP_000160435.1.91447 WP_000160435.1.91486 WP_000160435.1.91487 WP_000160435.1.91500 WP_000160435.1.91501 WP_000160435.1.91525 WP_000160435.1.91530 WP_000160435.1.91542 WP_000160435.1.91547 WP_000160435.1.9155 WP_000160435.1.91559 WP_000160435.1.91573 WP_000160435.1.91581 WP_000160435.1.91586 WP_000160435.1.91587 WP_000160435.1.91591 WP_000160435.1.91611 WP_000160435.1.91634 WP_000160435.1.91635 WP_000160435.1.91639 WP_000160435.1.91670 WP_000160435.1.917 WP_000160435.1.91704 WP_000160435.1.91745 WP_000160435.1.91749 WP_000160435.1.91771 WP_000160435.1.91781 WP_000160435.1.91791 WP_000160435.1.91800 WP_000160435.1.91816 WP_000160435.1.91829 WP_000160435.1.91848 WP_000160435.1.91895 WP_000160435.1.91911 WP_000160435.1.91918 WP_000160435.1.91928 WP_000160435.1.91950 WP_000160435.1.91955 WP_000160435.1.91969 WP_000160435.1.92 WP_000160435.1.92055 WP_000160435.1.92057 WP_000160435.1.92104 WP_000160435.1.92110 WP_000160435.1.92115 WP_000160435.1.92125 WP_000160435.1.92133 WP_000160435.1.92140 WP_000160435.1.92158 WP_000160435.1.92164 WP_000160435.1.92169 WP_000160435.1.92173 WP_000160435.1.92185 WP_000160435.1.92186 WP_000160435.1.92196 WP_000160435.1.92212 WP_000160435.1.92218 WP_000160435.1.92227 WP_000160435.1.9224 WP_000160435.1.92244 WP_000160435.1.92249 WP_000160435.1.92253 WP_000160435.1.92254 WP_000160435.1.92278 WP_000160435.1.92297 WP_000160435.1.923 WP_000160435.1.92303 WP_000160435.1.92324 WP_000160435.1.9234 WP_000160435.1.92340 WP_000160435.1.9239 WP_000160435.1.92391 WP_000160435.1.92415 WP_000160435.1.92424 WP_000160435.1.92425 WP_000160435.1.92436 WP_000160435.1.92442 WP_000160435.1.9247 WP_000160435.1.92479 WP_000160435.1.92497 WP_000160435.1.92500 WP_000160435.1.92512 WP_000160435.1.92520 WP_000160435.1.92534 WP_000160435.1.92541 WP_000160435.1.92544 WP_000160435.1.92560 WP_000160435.1.92565 WP_000160435.1.92602 WP_000160435.1.92607 WP_000160435.1.92667 WP_000160435.1.92674 WP_000160435.1.92679 WP_000160435.1.92691 WP_000160435.1.92718 WP_000160435.1.92723 WP_000160435.1.92726 WP_000160435.1.92735 WP_000160435.1.92741 WP_000160435.1.92765 WP_000160435.1.92772 WP_000160435.1.92773 WP_000160435.1.92778 WP_000160435.1.92789 WP_000160435.1.92795 WP_000160435.1.92805 WP_000160435.1.92840 WP_000160435.1.92848 WP_000160435.1.9286 WP_000160435.1.92862 WP_000160435.1.92864 WP_000160435.1.92918 WP_000160435.1.9293 WP_000160435.1.92937 WP_000160435.1.92950 WP_000160435.1.9296 WP_000160435.1.92960 WP_000160435.1.92965 WP_000160435.1.9298 WP_000160435.1.92997 WP_000160435.1.93010 WP_000160435.1.93041 WP_000160435.1.93047 WP_000160435.1.93068 WP_000160435.1.93071 WP_000160435.1.93074 WP_000160435.1.93078 WP_000160435.1.93125 WP_000160435.1.93141 WP_000160435.1.93147 WP_000160435.1.93163 WP_000160435.1.93176 WP_000160435.1.93191 WP_000160435.1.93197 WP_000160435.1.93207 WP_000160435.1.93224 WP_000160435.1.93231 WP_000160435.1.93235 WP_000160435.1.93237 WP_000160435.1.93243 WP_000160435.1.93251 WP_000160435.1.93254 WP_000160435.1.93260 WP_000160435.1.93272 WP_000160435.1.93300 WP_000160435.1.93310 WP_000160435.1.93329 WP_000160435.1.93336 WP_000160435.1.93354 WP_000160435.1.93378 WP_000160435.1.93416 WP_000160435.1.93438 WP_000160435.1.93444 WP_000160435.1.9346 WP_000160435.1.93471 WP_000160435.1.93492 WP_000160435.1.93514 WP_000160435.1.9352 WP_000160435.1.9354 WP_000160435.1.93561 WP_000160435.1.93567 WP_000160435.1.93579 WP_000160435.1.9358 WP_000160435.1.93590 WP_000160435.1.93613 WP_000160435.1.93658 WP_000160435.1.93678 WP_000160435.1.93708 WP_000160435.1.93710 WP_000160435.1.93722 WP_000160435.1.93736 WP_000160435.1.93738 WP_000160435.1.93758 WP_000160435.1.93762 WP_000160435.1.93769 WP_000160435.1.93775 WP_000160435.1.93787 WP_000160435.1.93862 WP_000160435.1.9387 WP_000160435.1.93882 WP_000160435.1.93883 WP_000160435.1.93890 WP_000160435.1.93891 WP_000160435.1.93934 WP_000160435.1.93972 WP_000160435.1.93976 WP_000160435.1.9398 WP_000160435.1.93981 WP_000160435.1.94 WP_000160435.1.94009 WP_000160435.1.94016 WP_000160435.1.94053 WP_000160435.1.94060 WP_000160435.1.94074 WP_000160435.1.9408 WP_000160435.1.94080 WP_000160435.1.94082 WP_000160435.1.94087 WP_000160435.1.94096 WP_000160435.1.9411 WP_000160435.1.94114 WP_000160435.1.94119 WP_000160435.1.94122 WP_000160435.1.94123 WP_000160435.1.94130 WP_000160435.1.94165 WP_000160435.1.94172 WP_000160435.1.94209 WP_000160435.1.94242 WP_000160435.1.94245 WP_000160435.1.94248 WP_000160435.1.94268 WP_000160435.1.94287 WP_000160435.1.94293 WP_000160435.1.94294 WP_000160435.1.9430 WP_000160435.1.94320 WP_000160435.1.94324 WP_000160435.1.94335 WP_000160435.1.94337 WP_000160435.1.94340 WP_000160435.1.94341 WP_000160435.1.94345 WP_000160435.1.9435 WP_000160435.1.9437 WP_000160435.1.94374 WP_000160435.1.94375 WP_000160435.1.94376 WP_000160435.1.94409 WP_000160435.1.94414 WP_000160435.1.94423 WP_000160435.1.94484 WP_000160435.1.94505 WP_000160435.1.94530 WP_000160435.1.94536 WP_000160435.1.94549 WP_000160435.1.9455 WP_000160435.1.94550 WP_000160435.1.94576 WP_000160435.1.94636 WP_000160435.1.9464 WP_000160435.1.94641 WP_000160435.1.94688 WP_000160435.1.947 WP_000160435.1.94733 WP_000160435.1.94741 WP_000160435.1.94789 WP_000160435.1.94797 WP_000160435.1.94825 WP_000160435.1.94844 WP_000160435.1.94845 WP_000160435.1.9485 WP_000160435.1.94857 WP_000160435.1.94866 WP_000160435.1.94941 WP_000160435.1.9495 WP_000160435.1.94958 WP_000160435.1.94969 WP_000160435.1.9497 WP_000160435.1.94980 WP_000160435.1.94989 WP_000160435.1.94999 WP_000160435.1.95008 WP_000160435.1.95014 WP_000160435.1.95023 WP_000160435.1.95029 WP_000160435.1.95033 WP_000160435.1.95049 WP_000160435.1.95075 WP_000160435.1.95077 WP_000160435.1.95090 WP_000160435.1.9510 WP_000160435.1.95120 WP_000160435.1.95156 WP_000160435.1.95174 WP_000160435.1.95210 WP_000160435.1.95263 WP_000160435.1.95281 WP_000160435.1.95294 WP_000160435.1.95304 WP_000160435.1.95318 WP_000160435.1.95327 WP_000160435.1.95342 WP_000160435.1.95361 WP_000160435.1.95372 WP_000160435.1.9538 WP_000160435.1.95386 WP_000160435.1.95409 WP_000160435.1.95415 WP_000160435.1.9544 WP_000160435.1.95452 WP_000160435.1.95494 WP_000160435.1.95500 WP_000160435.1.95512 WP_000160435.1.95519 WP_000160435.1.95522 WP_000160435.1.95537 WP_000160435.1.95545 WP_000160435.1.95550 WP_000160435.1.95560 WP_000160435.1.9557 WP_000160435.1.95571 WP_000160435.1.95581 WP_000160435.1.95603 WP_000160435.1.9563 WP_000160435.1.95639 WP_000160435.1.95681 WP_000160435.1.95683 WP_000160435.1.95699 WP_000160435.1.95704 WP_000160435.1.95713 WP_000160435.1.95714 WP_000160435.1.95737 WP_000160435.1.95760 WP_000160435.1.95780 WP_000160435.1.95781 WP_000160435.1.95804 WP_000160435.1.95806 WP_000160435.1.95832 WP_000160435.1.95877 WP_000160435.1.95885 WP_000160435.1.959 WP_000160435.1.95918 WP_000160435.1.95947 WP_000160435.1.95954 WP_000160435.1.95962 WP_000160435.1.95983 WP_000160435.1.95986 WP_000160435.1.95997 WP_000160435.1.96014 WP_000160435.1.96030 WP_000160435.1.96056 WP_000160435.1.96057 WP_000160435.1.96067 WP_000160435.1.96075 WP_000160435.1.96133 WP_000160435.1.96135 WP_000160435.1.96148 WP_000160435.1.96160 WP_000160435.1.96163 WP_000160435.1.96165 WP_000160435.1.9617 WP_000160435.1.96209 WP_000160435.1.96218 WP_000160435.1.96221 WP_000160435.1.96228 WP_000160435.1.96255 WP_000160435.1.96271 WP_000160435.1.96280 WP_000160435.1.96283 WP_000160435.1.96297 WP_000160435.1.96301 WP_000160435.1.96305 WP_000160435.1.96312 WP_000160435.1.96314 WP_000160435.1.96316 WP_000160435.1.96322 WP_000160435.1.96334 WP_000160435.1.96362 WP_000160435.1.96433 WP_000160435.1.96468 WP_000160435.1.96472 WP_000160435.1.96474 WP_000160435.1.96495 WP_000160435.1.9650 WP_000160435.1.96509 WP_000160435.1.96535 WP_000160435.1.96538 WP_000160435.1.96548 WP_000160435.1.96550 WP_000160435.1.96554 WP_000160435.1.96566 WP_000160435.1.96568 WP_000160435.1.96591 WP_000160435.1.96603 WP_000160435.1.96628 WP_000160435.1.96634 WP_000160435.1.96646 WP_000160435.1.96654 WP_000160435.1.96663 WP_000160435.1.96678 WP_000160435.1.96682 WP_000160435.1.96688 WP_000160435.1.96699 WP_000160435.1.96705 WP_000160435.1.96727 WP_000160435.1.9675 WP_000160435.1.96770 WP_000160435.1.96780 WP_000160435.1.96804 WP_000160435.1.96836 WP_000160435.1.9684 WP_000160435.1.96854 WP_000160435.1.96855 WP_000160435.1.96856 WP_000160435.1.96859 WP_000160435.1.96882 WP_000160435.1.96892 WP_000160435.1.96895 WP_000160435.1.96918 WP_000160435.1.96922 WP_000160435.1.96928 WP_000160435.1.9695 WP_000160435.1.96965 WP_000160435.1.96969 WP_000160435.1.96970 WP_000160435.1.96976 WP_000160435.1.96985 WP_000160435.1.96997 WP_000160435.1.97001 WP_000160435.1.97004 WP_000160435.1.97007 WP_000160435.1.97014 WP_000160435.1.97017 WP_000160435.1.97019 WP_000160435.1.97029 WP_000160435.1.97034 WP_000160435.1.97072 WP_000160435.1.97077 WP_000160435.1.97117 WP_000160435.1.97138 WP_000160435.1.97139 WP_000160435.1.97141 WP_000160435.1.97151 WP_000160435.1.97161 WP_000160435.1.97164 WP_000160435.1.97191 WP_000160435.1.97205 WP_000160435.1.97206 WP_000160435.1.97228 WP_000160435.1.97230 WP_000160435.1.97241 WP_000160435.1.97256 WP_000160435.1.97267 WP_000160435.1.97276 WP_000160435.1.97295 WP_000160435.1.97311 WP_000160435.1.97312 WP_000160435.1.97336 WP_000160435.1.97348 WP_000160435.1.97352 WP_000160435.1.97355 WP_000160435.1.97367 WP_000160435.1.9737 WP_000160435.1.97392 WP_000160435.1.97399 WP_000160435.1.97411 WP_000160435.1.97427 WP_000160435.1.9743 WP_000160435.1.97444 WP_000160435.1.97450 WP_000160435.1.97456 WP_000160435.1.97466 WP_000160435.1.97468 WP_000160435.1.97484 WP_000160435.1.97494 WP_000160435.1.97530 WP_000160435.1.97531 WP_000160435.1.97536 WP_000160435.1.97537 WP_000160435.1.97574 WP_000160435.1.97576 WP_000160435.1.97585 WP_000160435.1.97590 WP_000160435.1.97627 WP_000160435.1.97664 WP_000160435.1.97687 WP_000160435.1.97688 WP_000160435.1.97696 WP_000160435.1.97699 WP_000160435.1.97706 WP_000160435.1.97717 WP_000160435.1.97720 WP_000160435.1.97731 WP_000160435.1.97739 WP_000160435.1.97744 WP_000160435.1.97746 WP_000160435.1.97758 WP_000160435.1.97762 WP_000160435.1.97763 WP_000160435.1.97776 WP_000160435.1.97786 WP_000160435.1.97827 WP_000160435.1.97835 WP_000160435.1.9788 WP_000160435.1.9789 WP_000160435.1.97898 WP_000160435.1.97899 WP_000160435.1.97928 WP_000160435.1.97935 WP_000160435.1.97955 WP_000160435.1.97967 WP_000160435.1.97974 WP_000160435.1.97997 WP_000160435.1.97999 WP_000160435.1.98008 WP_000160435.1.98011 WP_000160435.1.98033 WP_000160435.1.98051 WP_000160435.1.98054 WP_000160435.1.98058 WP_000160435.1.98073 WP_000160435.1.98077 WP_000160435.1.98131 WP_000160435.1.98161 WP_000160435.1.98174 WP_000160435.1.98179 WP_000160435.1.98191 WP_000160435.1.98195 WP_000160435.1.98233 WP_000160435.1.98242 WP_000160435.1.98248 WP_000160435.1.98249 WP_000160435.1.98281 WP_000160435.1.98295 WP_000160435.1.98307 WP_000160435.1.98328 WP_000160435.1.98352 WP_000160435.1.98353 WP_000160435.1.98359 WP_000160435.1.98360 WP_000160435.1.98361 WP_000160435.1.98366 WP_000160435.1.98372 WP_000160435.1.98379 WP_000160435.1.98387 WP_000160435.1.98394 WP_000160435.1.98409 WP_000160435.1.98411 WP_000160435.1.98415 WP_000160435.1.98425 WP_000160435.1.98456 WP_000160435.1.98501 WP_000160435.1.98506 WP_000160435.1.98512 WP_000160435.1.98533 WP_000160435.1.98552 WP_000160435.1.98585 WP_000160435.1.98586 WP_000160435.1.986 WP_000160435.1.98609 WP_000160435.1.98655 WP_000160435.1.98659 WP_000160435.1.98667 WP_000160435.1.98703 WP_000160435.1.98706 WP_000160435.1.9872 WP_000160435.1.98723 WP_000160435.1.98730 WP_000160435.1.98734 WP_000160435.1.98741 WP_000160435.1.98750 WP_000160435.1.98767 WP_000160435.1.98786 WP_000160435.1.98797 WP_000160435.1.98821 WP_000160435.1.98825 WP_000160435.1.98837 WP_000160435.1.98842 WP_000160435.1.98858 WP_000160435.1.98865 WP_000160435.1.98874 WP_000160435.1.98880 WP_000160435.1.98883 WP_000160435.1.98894 WP_000160435.1.98924 WP_000160435.1.98967 WP_000160435.1.98978 WP_000160435.1.98985 WP_000160435.1.99009 WP_000160435.1.99025 WP_000160435.1.99090 WP_000160435.1.9910 WP_000160435.1.9912 WP_000160435.1.99136 WP_000160435.1.99155 WP_000160435.1.99171 WP_000160435.1.99195 WP_000160435.1.99207 WP_000160435.1.99217 WP_000160435.1.99237 WP_000160435.1.99249 WP_000160435.1.99262 WP_000160435.1.99280 WP_000160435.1.99283 WP_000160435.1.99308 WP_000160435.1.99311 WP_000160435.1.99359 WP_000160435.1.9936 WP_000160435.1.99394 WP_000160435.1.99405 WP_000160435.1.99414 WP_000160435.1.99418 WP_000160435.1.99430 WP_000160435.1.99459 WP_000160435.1.99492 WP_000160435.1.99494 WP_000160435.1.99509 WP_000160435.1.99519 WP_000160435.1.99523 WP_000160435.1.99525 WP_000160435.1.99536 WP_000160435.1.99538 WP_000160435.1.99564 WP_000160435.1.99569 WP_000160435.1.9960 WP_000160435.1.99631 WP_000160435.1.99638 WP_000160435.1.9965 WP_000160435.1.99683 WP_000160435.1.99686 WP_000160435.1.99688 WP_000160435.1.99700 WP_000160435.1.99759 WP_000160435.1.99768 WP_000160435.1.99777 WP_000160435.1.99802 WP_000160435.1.99830 WP_000160435.1.99849 WP_000160435.1.9985 WP_000160435.1.99850 WP_000160435.1.99859 WP_000160435.1.99860 WP_000160435.1.9987 WP_000160435.1.99884 WP_000160435.1.99901 WP_000160435.1.99926 WP_000160435.1.99934 WP_000160435.1.99950 WP_000160435.1.99954 WP_000160435.1.99955 WP_000160435.1.99956 WP_000160435.1.99963 WP_000160435.1.99979 WP_000160435.1.99984 WP_000160435.1.99999 YP_500318.1.76163 gi|470219169|ref|YP_007619563.1| gi|379021480|ref|YP_005298142.1| gi|379014904|ref|YP_005291140.1| gi|537461393|ref|YP_008491833.1| gi|470193501|ref|YP_007579854.1| gi|554644512|ref|YP_008716303.1| gi|82751292|ref|YP_417033.1| gi|521212509|ref|YP_008168855.1| gi|545638032|ref|YP_008588208.1| gi|151221811|ref|YP_001332633.1| gi|148268184|ref|YP_001247127.1| gi|150394251|ref|YP_001316926.1| gi|269203342|ref|YP_003282611.1| gi|156980022|ref|YP_001442281.1| gi|470197432|ref|YP_007583833.1| gi|470224957|ref|YP_007623536.1| gi|384870243|ref|YP_005752957.1| gi|537443002|ref|YP_008485579.1| gi|470222990|ref|YP_007621547.1| gi|384547925|ref|YP_005737178.1| gi|470195467|ref|YP_007581819.1| gi|386831303|ref|YP_006237957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]