SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|143122|fgenesh1_pg.9_#_181 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|143122|fgenesh1_pg.9_#_181
Domain Number 1 Region: 615-797
Classification Level Classification E-value
Superfamily Terpenoid synthases 4.5e-58
Family Isoprenyl diphosphate synthases 0.0000000181
Further Details:      
 
Domain Number 2 Region: 911-1110
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.72e-42
Family ABC transporter ATPase domain-like 0.014
Further Details:      
 
Domain Number 3 Region: 2-122
Classification Level Classification E-value
Superfamily NusB-like 4.84e-32
Family Antitermination factor NusB 0.00079
Further Details:      
 
Domain Number 4 Region: 801-875
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-20
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.00022
Further Details:      
 
Domain Number 5 Region: 1205-1399
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.9e-17
Family ABC transporter ATPase domain-like 0.013
Further Details:      
 
Domain Number 6 Region: 555-591
Classification Level Classification E-value
Superfamily XseB-like 0.00000000183
Family XseB-like 0.004
Further Details:      
 
Domain Number 7 Region: 877-920
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 0.0000000432
Family C-terminal domain of arginine repressor 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|143122|fgenesh1_pg.9_#_181
Sequence length 1450
Sequence
MSRKESRVQAFQTLFQLEMKDSDLTINEAISFIKDDNPDLDFEFIHWLVSGVKDHEPVLD
ETISPYLKDWTIARLLKTDRIILRMATYEILHSDTPAKVVMNEAVELTKQFSDDDHYKFI
NDYLSVSALTKYIKYKFDQDPHLQSVLIKGELSNFKKHSSGHLYFNVKDKESVISAMMFK
GSASKLNFEPKEGDEVLLEARVSVFERRGNYQIYVNKMQLDGIGNLYQKLEALKKKLTEE
GCFDKANKKSIPKFPKKIAVLTASTGAAIRDIHSTINSRFPLAEQIQISTLVQGEKAKDD
IIEKIEYADSLGVDTIIVGRGGGSIEDLWNFNEEAVVRAIYNCKTPIISAVGHETDFTLS
DFAADIRAATPTQAAVIATPDQYELLQQIQQYQFTLTRFIKKHLEQQRKHVEHLSSYYKF
KQPTLLYDQQIQRRDDLEKRLKQQIQATFEQQRHRLMLLQQRYNLKALLSSVNQEQQNNL
QLTNQLVKLLNSKILSYKNDLKNKVENLNNLSPTNTMLRGYAIVNKKDEVITSTKDLTEN
DQLTLTMKDGLVDAKVTKVSFEEMMQELEQIVQKLDNETVSLEESLDLYQRDEVNNELSV
AINKSVMDTQLEENSLNTEYELGMKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHK
VYGDALLTKAFELISSDDRLTDEVKIKVLQRLSIASGHVGMVGGQMLDMQSEGQPIDLET
LEMIHKTKTGALLTFAVMSAADIANVDDATKEHLESYSYHLGMMFQIKDDLLDCYGDEAK
LGKKVGSDLENNKKVFTVPKKSVRHIKIREIISNEQIETQDELVKRLNDYDLNVTQATVS
RDIKELQLIKVPIPSGQYVYSLPNDRKFHPLEKLGRYLMDSFVNIDGTDNLLVLKTLPGN
AQSIGAILDQINWEEQFAIIEELEIQFSDGLTVLSGETGSASSDFVRHGEKKAVIEGIFD
IDESKDAIHILKNMDIDVDEDFLLVKREIFSSGKSLCKINNQTVTLQDLRKVMQELLDIH
GQHETQSLLKQKYHLTLLDNYAESRYQDLLDKYHQTFQNYKAKKQELEDLESADQALLQR
LDLMKFQLEELSEAHLKEGEIEQLEIDIKRIQNSEKLSLALNNAHMTLTDENAITDRLYE
LSNHLLTINDIVPNKYDKLKEDIDQFYYILEDAKHELYDEMANTEFDEQVLNEYESRMNL
LNNLKRKYGKDISELIAYQEKLNNEINKIENYEQSTSQLREEINALYNQVIEVGQALSKQ
RRIVARELRDHIVSEIQNLQMKDANLEISFKKLEEPNIDGIEFVEFLISPNKGEPLKSLN
KIASGGELSRIMLALKSIFVKSRGQTAILFDEVDSGVSGQAAQKMAEKMRDIAEYIQVIC
ISHLPQVASMSDHHLLISKSSKDDRTTTQVQELISDDKVDEIARMISGASVTDLTRENAR
EMIQHNQRRR
Download sequence
Identical sequences jgi|Aspzo1|143122|fgenesh1_pg.9_#_181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]