SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|143301|fgenesh1_pg.9_#_360 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|143301|fgenesh1_pg.9_#_360
Domain Number 1 Region: 159-571
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.52e-77
Family beta-Lactamase/D-ala carboxypeptidase 0.00000705
Further Details:      
 
Domain Number 2 Region: 26-206
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 5.36e-44
Family Penicillin binding protein dimerisation domain 0.0000489
Further Details:      
 
Domain Number 3 Region: 564-619
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000000000131
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0025
Further Details:      
 
Domain Number 4 Region: 622-676
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000131
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|143301|fgenesh1_pg.9_#_360
Sequence length 708
Sequence
MITGHSNGQDLVMKANEKYLVKNAQQPERGKIYDRNGKVLAEDVERYKLVAVIDKKASAN
SKKPRHVVDKKETAKKLSTVIDMKPEEIEKRLSQKKAFQIEFGRKGTNLTYQDKLKIEKM
NLPGISLLPETERFYPNGNFASHLIGRAQKNPDTGELKGALGVEKIFDSYLSGSKGSLRY
IHDIWGYIAPNTKKEKQPKRGDDVHLTIDSNIQVFVEEALDGMVERYQPKDLFAVVMDAK
TGEILAYSQRPTFNPETGKDFGKKWANDLYQNTYEPGSTFKSYGLAAAIQEGAFDPDKKY
KSGHRDIMGSRISDWNRVGWGEIPMSLGFTYSSNTLMMHLQDLVGADKMKSWYERFGFGK
STKGMFDGEAPGQIGWSNELQQKTSSFGQSTTVTPVQMLQAQSAFFNDGNMLKPWFVNSV
ENPVSKRQFYKGQKQIAGKPITKDTAEKVEKQLDLVVNSKKSHAANYRIDGYEVEGKTGT
AQVAAPNGGGYVKGPNPYFVSFMGDAPKKNPKVIVYAGMSLAQKNDQEAYELGVSKAFKP
IMENTLKYLNVGKSKDDTSNAEYSKVPDVEGQDKQKAIDNVSAKSLEPVTIGSGTQIKAQ
SIKAGNKVLPHSKVLLLTDGDLTMPDMSGWTKEDVIAFENLTNIKVNLKGSGFVSHQSIS
KGQKLTEKDKIDVEFSSENVDSNSTNNSDSNSDDKKKSDSKTDKDKSD
Download sequence
Identical sequences A0A2K1SJT9
gi|384867937|ref|YP_005748133.1| jgi|Aspzo1|143301|fgenesh1_pg.9_#_360 WP_000627769.1.100184 WP_000627769.1.100335 WP_000627769.1.159 WP_000627769.1.17847 WP_000627769.1.43984 WP_000627769.1.45768 WP_000627769.1.52886 WP_000627769.1.59567 WP_000627769.1.70413 WP_000627769.1.72787 WP_000627769.1.74173 WP_000627769.1.77848 WP_000627769.1.78116 WP_000627769.1.81718 WP_000627769.1.8643 WP_000627769.1.97004 WP_000627769.1.98191 WP_000627769.1.98750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]