SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|143385|fgenesh1_pg.9_#_444 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|143385|fgenesh1_pg.9_#_444
Domain Number 1 Region: 3-199
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.43e-57
Family RelA/SpoT domain 0.000000436
Further Details:      
 
Domain Number 2 Region: 436-616
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.2e-53
Family Pseudouridine synthase RsuA/RluD 0.00024
Further Details:      
 
Domain Number 3 Region: 208-388
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.89e-50
Family NAD kinase-like 0.00072
Further Details:      
 
Domain Number 4 Region: 910-1060
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 2.48e-39
Family MgtE membrane domain-like 0.0000556
Further Details:      
 
Domain Number 5 Region: 769-906
Classification Level Classification E-value
Superfamily CBS-domain pair 1.52e-33
Family CBS-domain pair 0.00000564
Further Details:      
 
Domain Number 6 Region: 645-767
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 2.49e-26
Family MgtE N-terminal domain-like 0.0000541
Further Details:      
 
Domain Number 7 Region: 1461-1570
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000000000125
Family Potassium channel NAD-binding domain 0.032
Further Details:      
 
Domain Number 8 Region: 1596-1667
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.0000000051
Family TrkA C-terminal domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|143385|fgenesh1_pg.9_#_444
Sequence length 1670
Sequence
MNQWDQFLTPYKQAVDELKVKLKGMRKQYEVGEQASPIEFVTGRVKPIASIIDKANKRQI
PFDRLREEMYDIAGLRMMCQFVEDIDVVVNILRQRKDFKVIEERDYIRNTKESGYRSYHV
IIEYPIETLQGQKFILAEIQIRTLAMNFWATIEHTLRYKYDGAYPDEIQHRLERAAEAAY
LLDEEMSEIKDEIQEAQKYYTQKRDSKSNALKHKMMNYMKDFRMIEDSENPEIVISVGGD
GTLLQAFHQYSHMLSKVAFVGVHTGHLGFYADWLPHEVEKLIIEINNSEFQVIEYPLLEI
IMRYNDNGYETRYLALNEATMKTENGSTLVVDVNLRGKHFERFRGDGLCVSTPSGSTAYN
KALGGALIHPSLEAMQITEIASINNPRHDFSKKTVSAIKNNGALIVNDEPVTVRKQLMPN
DILEIHLPREIPSVNLIPYARKLEVLYEDAFIIIVTKPNNQNCTPSREHPHESLIEQVLY
HCQEHGENINPHIVTRLDRNTTGIVIFAKYGHIHHLFSKVNLKKIYTCLVYGKTHTSGII
EANIRRSKDSIITREVASDGKYAKTSYEVINQNDKYSLCKVHLHTGRTHQIRVHFQHIGH
PIVGDSLYDGFHDKIHGQVLQWGVSMSMNTDEKERVQEELYDETLLDQYLENDDIDQFRD
EFLALHTYEQSEYFEDTTDENRQKIFQYLSPEEVANFFDQLDIDDDEYELLFDKMNATYA
SHILEEMSYDNAVDILNELTKPKVASLLTLMNKDDANEIKALLHYDEDTAGGIMTTEYLS
LKAHTPVKEALLLVKAQAPDAETIYVIFVVDDDGKLVGVLSLRDLIVAENDAYIEDIMNE
RVISVNVADDQEDVAQVMRDYDFMAVPVIDYQEHLLGIITIDDILDVMDEEASEDYSRLA
GVSDIDSTNDSIIKTALKRLPWLIILTFLGMITATILGRFEKTLENVALLAAFIPIISGM
SGNSGTQSLAVSVRNITTGEINEQSKFRIALREAGSGVLSGVPLLALIVAGSLTCAMTVG
TFVGSMIPLLMNKLNIDPAVASGPFITTINDIIRGVMEFLSLVIVVLAAFLTPIIVNRLN
INFLPVVVAEILMGIVIGNSFLNIVERDSILNILSTLGFIFLMFLSGLEIDFKAFKKDKR
ARQGQNDDESSIPGHLNLALTVFAFIMIISILLAYVFKWLGLVDDVLLMVIIISTISLGV
VVPTLKEMNIMRTTIGQFILLVAVLADLVTMILLTVYGAINGQGGSTIWLIGILVVFTAI
SYILGVQFKRMSFLQKLMDGTTQIGIRAVFALIILLVALAEGVGAENILGAFLAGVVVSL
LNPDEEMVEKLDSFGYGFFIPIFFIMVGVDLNIPSLIKEPKLLIIIPILIVAFIISKLIP
VMFIRRWFDMKTTIASAFLLTSTLSLVIAAAKISERLNAISAETSGILILSAVITCVFVP
IIFKKLFPVPDEFNRKIEVSLIGKNQLTIPIAQNLTSQLYDVTLYYRKDLSDRRQLSDDI
TMIEIADYEQDVLERLGLFDRDIVVCATNDDDINRKVAKLAKAHQVERVICRLESTTDDT
ELVDSGIEIFSSYLSNKILLKGLIETPNMLNLLSNVETSLYEIQMLNYKYENIQLRNFPF
GGDIIFVRIIRNNESIVPHGDTQLRYGDRLIVTGAKEYVDELKQELEFYF
Download sequence
Identical sequences jgi|Aspzo1|143385|fgenesh1_pg.9_#_444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]