SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|145360|fgenesh1_pg.16_#_44 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Aspzo1|145360|fgenesh1_pg.16_#_44
Domain Number - Region: 104-142
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.011
Family Rho termination factor, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|145360|fgenesh1_pg.16_#_44
Sequence length 493
Sequence
MDNSEQRFIETLISKGNPVTIVNSRDVNMLKLTNHLGFVYQLNEDEFFVNNFFLRYINSE
VLDNAYGEFESLDTINHMNLNEEVLRVRQHTRLNDVTLEHALLLKTNDELKTICRQYGIK
GFSNKNKQNLVELIMTAFFNNNHIIEQVFSNATLFEFDILSSILESDDNYRLNNELTKFE
KLQLINFDNFLTIHFYYYYDFEYDCLILPNDVRKHIENFVNQVGNGYFEKAVNQFVDEQT
IENSLAEFKNALELSFMEDEVDLDMLLEDDDFEDFGTTDSLRSDAITQLISEIKKGLIDK
KDILPLRIILGSVNLYGILSTNHLLYLLQRFYDATFSKEELQYSLDTLAGTELYYVEDDF
VFHPVLFDVVESEASGIDISDDGYYVPASVEELIYYDRHHYLKSDQAIKEFTSYLRKQIN
MKNDIEKEKYVNEIIMLLRTIPTSKLIQPIMQLFIDNAILNNVQNDALLIEKATHARNHL
RLWSLQGHRDIPN
Download sequence
Identical sequences jgi|Aspzo1|145360|fgenesh1_pg.16_#_44

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]