SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|145368|fgenesh1_pg.16_#_52 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|145368|fgenesh1_pg.16_#_52
Domain Number 1 Region: 27-117
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00000000000000157
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0029
Further Details:      
 
Domain Number 2 Region: 119-187
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000108
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0019
Further Details:      
 
Domain Number 3 Region: 191-286
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0000000641
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|145368|fgenesh1_pg.16_#_52
Sequence length 293
Sequence
MNQVMNIISSLFEPLTKIETYENIATKIAMIVIYIIVALIVIKILNKMIEQGFKIQNKSK
KSNKKRSKTLISLVQNVVKYIVWFIVITTILSKFGISVEGVIASAGVVGLAVGFGAQTIV
KDVITGFFIIFESQFDVGDYVKINNGGTTVAEGTVKSIGLRSTRINTISGELTILPNSSM
GEITNYSITNGTAIVKIPVSVDENIDNVEKKLNKLFTSLRSKYYLFVSDPVVIGIDAFED
TRVILRVSAETIPGEGFSGARIIRKEVQKMFLQEGIKTPQPIMTPFNHSENGV
Download sequence
Identical sequences A0A0E1VNG2 A0A2K4AIS3
WP_001077600.1.14924 WP_001077600.1.15478 WP_001077600.1.2 WP_001077600.1.22180 WP_001077600.1.22237 WP_001077600.1.24685 WP_001077600.1.25262 WP_001077600.1.29554 WP_001077600.1.34128 WP_001077600.1.41647 WP_001077600.1.46423 WP_001077600.1.54806 WP_001077600.1.83508 WP_001077600.1.8617 WP_001077600.1.89857 WP_001077600.1.97468 jgi|Aspzo1|145368|fgenesh1_pg.16_#_52

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]