SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|145369|fgenesh1_pg.16_#_53 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|145369|fgenesh1_pg.16_#_53
Domain Number 1 Region: 137-248
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 5.23e-33
Family KorB DNA-binding domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 56-147
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 3.4e-28
Family ParB-like nuclease domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|145369|fgenesh1_pg.16_#_53
Sequence length 316
Sequence
MLTEQLSQFKSLSLQSKKRFVNNYSENFDLKVNFDVSELSKSEDQRITKTKDEQIKQIDI
SDIKPNPYQPRKTFDENHLNDLADSIKQYGILQPIVLRKTVQGYYIVVGERRFRASKIAG
LKYVSAIIKDLTDEDMMELAVIENLQREDLNAIEEAESYQRLMTDLKITQQEVAKRLSKS
RPYIANMLRLLHLPKKIADMVKDGRLTSAHGRTLLAIKDEQQMLRLAKRVVKEKWSVRYL
ENHVNELKNVSSKSETDKVDITKPKFIKQQERQLREQYGTKVDISIKKSVGKISFEFDSQ
EDFLRIIEQLNRRYGK
Download sequence
Identical sequences jgi|Aspzo1|145369|fgenesh1_pg.16_#_53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]