SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|145490|fgenesh1_pg.16_#_174 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|145490|fgenesh1_pg.16_#_174
Domain Number 1 Region: 33-316
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 1.64e-56
Family TM0189-like 0.002
Further Details:      
 
Domain Number 2 Region: 332-575
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 5.62e-53
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.0000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|145490|fgenesh1_pg.16_#_174
Sequence length 580
Sequence
MLVVTLAFLLVLAGCSGNSNKQSSDNKDKETTSIKHAMGTTEIKGKPKRVVTLYQGATDV
AVSLGVKPVGAVESWTQKPKFEYIKNDLKDTKIVGQEPAPNLEEISKLKPDLIVASKVRN
EKVYDQLSKIAPTVSTDTVFKFKDTTKLMGKALGKEKEAEDLLKKYDDKVAAFQKDAKAK
YKDAWPLKASVVNFRADHTRIYAGGYAGEILNDLGFKRNKDLQKQVDNSKDIIQLTSKES
IPLMNADHIFVVKSDPNAKDAALVKKTESEWTSSKEWKNLDAVKNNQVSDDLDEITWNLA
GGYKSSLKLIDDLYENSYLKFNDWKYACVTSENDLHDVVTGARASRTIIALLTGAALAVS
ASPGLFGVNAGAVFFVIFSITFIQIQSFKMIVVIAFLGAIVVTILVVALAFTQGILIMNE
TDLQGLLFWLSGSVSLRNIWDIPWIIPLVLILILIAFSMAAHINILMTSDDIATGLGQNI
KLIKWMIIMLISMLAGISVAVAGSIIFVGLIVPNISKRLLPPNYKYLIPFTALAGAILMI
ISDIVARIIIKPLELPIGVVTAVIGAIVLIYIMKKGRQRL
Download sequence
Identical sequences jgi|Aspzo1|145490|fgenesh1_pg.16_#_174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]