SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|145551|fgenesh1_pg.16_#_235 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|145551|fgenesh1_pg.16_#_235
Domain Number 1 Region: 135-369,648-689
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.62e-58
Family Tandem AAA-ATPase domain 0.00000228
Further Details:      
 
Domain Number 2 Region: 720-930
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 1.96e-40
Family Helical scaffold and wing domains of SecA 0.0014
Further Details:      
 
Domain Number 3 Region: 542-706
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.59e-36
Family Tandem AAA-ATPase domain 0.0000154
Further Details:      
 
Domain Number 4 Region: 369-491
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 5.49e-35
Family Pre-protein crosslinking domain of SecA 0.00021
Further Details:      
 
Domain Number 5 Region: 1093-1384
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.41e-31
Family Glycosyl transferases group 1 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|145551|fgenesh1_pg.16_#_235
Sequence length 1854
Sequence
MINVIIAEPSDVYPTISNDFLKPFGHVWLVERWMEDDIKENIKQLKDDLQSQDTLTAINL
ISYGSKSNVFATYVAQHLDCKVYRTSHEDDDLKEWLKEHVPGNHELKDTNVEVYFKEEQD
NHLNYMSRLMNPVRFLDYLDVSKLNDVTINELRLKSIRKIVKRINTWGDEVKSYSDDALK
QKTIEFKERLASGVDTLDTLLPEAYAVAREASWRVLGMYPKEVQLIGAIVLHEGNIAEMQ
TGEGKTLTATMPLYLNALSGKGTYLITTNDYLAKRDFEEMQPLYEWLGLTASLGFVDIVD
YEYQKGEKRNLYEHDIIYTTNGRLGFDYLIDNLADSAEGKFLPQLNYGIIDEVDSIILDA
AQTPLVISGAPRLQSNLFHIVKEFVDTLIEDVHFKMKKTKKEIWLLNQGIEAAQSYFNVE
DLYSEQAMVLVRNINLALRAQYLFESNVDYFVYNGDIVLIDRITGRMLPGTKLQAGLHQA
IEAKEGMEVSTDKSVMATITFQNLFKLFESFSGMTATGKLGESEFFDLYSKIVVQVPTDK
AIQRIDEPDKVFRSVDEKNIAMIHDIVELHETGRPVLLITRTAEAAEYFSKVLFQMDIPN
NLLIAQNVAKEAQMIAEAGQIGSMTVATSMAGRGTDIKLGEGVEALGGLAVIIHEHMENS
RVDRQLRGRSGRQGDPGSSCIYISLDDYLVKRWSDSNLAENNQLYSLDAQRLSQSNLFNR
KVKQIVVKAQRISEEQGVKAREMANEFEKSISIQRDLVYEERNRVLEIDDAENRDFKALA
KDVFEMFVNEEKVLTKSRVVEYIYQNLSFQFNKDVACVNFKDKQAVVTFLLEQFEKQLAL
NRKNMQSAYYYNIFVQKVFLKAIDSCWLEQVDYLQQLKASVNQRQNGQRNAIFEYHRVAL
DSFEVMTRNIKKRMVKNICQSMITFDKEGWASSGVEYAQAYRAKLLRRTNQDTKFVFLDF
IQSENIQTLTQNIGFKDQEVIWLYQYFSDISIAPTTYTLDDIERELGHEISFRERNGKIV
RLYFNGKSSFVTCYLQNEQKDVVDRAEFVINSMLVRKDFYSYTRIFSEYYAPADNKAKLY
MRQFYNEDGSIAYNEYIDGDSSIYVFEDAVLYNKTEFIAYFLQRLNLTRDDIVILDRASD
IGQAVLQHKGDSKVGVVIHADHYSNNMMSEQHILWNNYYEYQFSKAKYIDFFITATDIQN
HMVCRQFEQYQGYRPRVYTIPVGSIDALSYPTLSRKPYAMISASRLANEKHIDWLVKAVI
VAKRQVPELTFDIYGEGSEKTRLRKIIDTHRAQDYIRLLGHVKLDEIYNDYELFLSASTS
EGFGLTLMEAVGSGLGMIGLNVNYGNPTFIRDGENGYLVPFDTDEDSVDDVVAKLAHAIV
MYFNNGPQTPHDISYEVAQQFMTQDIILKWETLVQELYESFKASKLEEDLTIVLNDNGFL
PDDVISPYQFFADNHNTENMKPRFFNQVTVPAFWEIKGNNNSATINDMGRLRGKIFYQSG
ERPRIVSRVEWFDDQQRVRFVDYYSKNGIKFAQTVYDLNRKAILKKYMTAEGKEVIYENF
VTSDVILDWQGKSYFFPSKLAFVLFFIKQLEITEHHFVINSLALPFSVLYNLPSNGSDVL
VWQEQCDGNVPGNMQLMCKGDMKRHCNIIIPDKNEYETMLNIADAKVQSRILQGGYLYNY
RSRNRYTKEIVILTNSDQLRNIKVLVETLPDFNFHIAAITEMSDKLMQLDQYANVHLYPS
INIDRVNELYQLCDIYLDINEGNEILNAVEQAFDYELLILGYRQTAHHAKVTLSEHLFEH
NDEITMESKDQLIQMLESLKDQQQFRDALLAQKAHAHEISREQFEQVFKQALES
Download sequence
Identical sequences jgi|Aspzo1|145551|fgenesh1_pg.16_#_235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]