SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|145631|fgenesh1_pg.16_#_315 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|145631|fgenesh1_pg.16_#_315
Domain Number 1 Region: 2-218
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.05e-28
Family BC1024-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|145631|fgenesh1_pg.16_#_315
Sequence length 233
Sequence
MTDDAERNYKFFTEVLGMRLVKKTVNQDDIYTYHTFFADDVGSAGTDMTFFDFPNITKGQ
AGTNSITRPSFRVPNDDALMYYEQRFDEFGVKHEGIQELFGKKVLPFEEVDGQVYQLISD
ELNDGVAPGVPWKNGPVPVDKAIYGLGPIEIKTVYGMTTIAHEDNVALLEVGEGGNGGQV
ILIKDDKGPAARQGYGEVHHVSFRVKDHDAIEAWATKYKEMDQDLWKMNRMKH
Download sequence
Identical sequences jgi|Aspzo1|145631|fgenesh1_pg.16_#_315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]