SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|146619|fgenesh1_pg.23_#_42 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|146619|fgenesh1_pg.23_#_42
Domain Number 1 Region: 10-232,354-401
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.19e-72
Family Tandem AAA-ATPase domain 0.0000000838
Further Details:      
 
Domain Number 2 Region: 577-792,821-833
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 3.66e-71
Family Helical scaffold and wing domains of SecA 0.000000807
Further Details:      
 
Domain Number 3 Region: 403-575
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.29e-51
Family Tandem AAA-ATPase domain 0.000000556
Further Details:      
 
Domain Number 4 Region: 231-354
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 6.8e-48
Family Pre-protein crosslinking domain of SecA 0.0000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|146619|fgenesh1_pg.23_#_42
Sequence length 843
Sequence
MGFLSKILDGNNKEIKQLGKLADKVIALEEKTAILTDEEIRNKTKQFQTELADIDNVKKQ
NDYLDKILPEAYALVREGSKRVFNMTPYKVQIMGGIAIHKGDIAEMRTGEGKTLTATMPT
YLNALAGRGVHVITVNEYLSSVQSEEMAELYNFLGLTVGLNLNSKTTEEKREAYAQDITY
STNNELGFDYLRDNMVNYSEDRVMRPLHFAIIDEVDSILIDEARTPLIISGEAEKSTSLY
TQANVFAKMLKQDEDYKYDEKTKAVHLTEQGADKAERMFKVENLYDVQNVDVISHINTAL
RAHVTLQRDVDYMVVDGEVLIVDQFTGRTMPGRRFSEGLHQAIEAKEGVQIQNESKTMAS
ITFQNYFRMYNKLAGMTGTAKTEEEEFRNIYNMTVTQIPTNKPVQRNDKSDLIYISQKGK
FDAVVEDVVEKHKAGQPVLLGTVAVETSEYISNLLKKRGIRHDVLNAKNHEREAEIVAGA
GQKGTVTIATNMAGRGTDIKLGEGVEELGGLAVIGTERHESRRIDDQLRGRSGRQGDKGD
SRFYLSLQDELMIRFGSERLQKMMSRLGLDDSTPIESKMVSRAVESAQKRVEGNNFDARK
RILEYDEVLRKQREIIYNERNSIIDEEDSSQVVDAMLRSTLQRSINYYINTADDEPEYQP
FIDYINDIFLQEGDITEDDIKGKDAEDIFEVVWAKIEAAYQSQKDILEEQMNEFERMILL
RSIDSHWTDHIDTMDQLRQGIHLRSYAQQNPLRDYQNEGHELFDIMMQNIEEDTCKFILK
SVVQVEDNIEREKTTEFGEAKHVSAEDGKEKVKPKPIVKGDQVGRNDDCPCGSGKKFKNC
HGK
Download sequence
Identical sequences jgi|Aspzo1|146619|fgenesh1_pg.23_#_42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]