SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|146684|fgenesh1_pg.23_#_107 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|146684|fgenesh1_pg.23_#_107
Domain Number 1 Region: 550-858
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 7.98e-74
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.0000153
Further Details:      
 
Domain Number 2 Region: 265-549
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 1.57e-63
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.0000366
Further Details:      
 
Domain Number 3 Region: 6-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.89e-61
Family ABC transporter ATPase domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|146684|fgenesh1_pg.23_#_107
Sequence length 862
Sequence
MNRLHGQQVKIGYGDNTIINKLDVEIPDGKVTSIIGPNGCGKSTLLKALSRLLAVKEGEV
FLDGENIHTQSTKEIAKKIAILPQSPEVADGLTVGELVSYGRFPHQKGFGRLTAEDKKEI
DWAMEVTGTDTFRHRSINDLSGGQRQRVWIAMALAQRTDIIFLDEPTTYLDICHQLEILE
LVQKLNQEQGCTIVMVLHDINQAIRFSDHLIAMKEGDIIATGSTEDVLTQEILEKVFNID
VVLSKDPKTGKPLLSLFLIKENPTPLKFLSYIIGLSMILLITLFISTLIGDAKIQASTII
EAIFNYNPSNQQQNIINEIRIPRNIAAVIVGMALAVSGAIIQGVTRNGLADPALIGLNSG
ASFALALTYAVLPNTSFLILMFAGFLGAILGGAIVLMIGRSRRDGFNPMRIILAGAAVSA
MLTALSQGIALAFRLNQTVTFWTAGGVSGTTWSHLKWAIPLIGIALFIILTISKQLTILN
LGESLAKGLGQNVTMIRGICLIIAMILAGIAVAIAGQVAFVGLMVPHIARFLIGTDYAKI
LPLTALLGCTWSITSGEYNIPVERFFKTLIGQGDAIDELILLDFRLPRMMITILAGAALS
ISGAIVQSVTKNPIAEPGILGINAGGGFAIALFIAIGKINADNFVYVLPLISILGGITTA
LIIFIFSFNKNEGVTPASMVLIGVGLQTALYGGSITIMSKFDDKQSDFIAAWFAGNIWGD
EWPFVIAFLPWVLIIIPYLLFKSNTLNIIHTGDNIARGLGVRLSRERLILFFIAVMLSSA
AVAVAGSISFIGLMGPHIAKRIVGPRHQLFLPIAILVGACLLVIADTIGKIVLQPGGVPA
GIVVAIIGAPYFLYLMYKTKNV
Download sequence
Identical sequences jgi|Aspzo1|146684|fgenesh1_pg.23_#_107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]