SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|146749|fgenesh1_pg.23_#_172 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|146749|fgenesh1_pg.23_#_172
Domain Number 1 Region: 8-119
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 4.97e-39
Family N-utilization substance G protein NusG, N-terminal domain 0.0000446
Further Details:      
 
Domain Number 2 Region: 126-182
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.42e-18
Family N-utilization substance G protein NusG, C-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|146749|fgenesh1_pg.23_#_172
Sequence length 182
Sequence
MSEEVGAKRWYAVHTYSGYENKVKKNLEKRVESMNMTEQIFRVVIPEEEETQVKDGKAKT
TVKKTFPGYVLVELIMTDESWYVVRNTPGVTGFVGSAGAGSKPNPLLPEEVRFILKQMGL
KEKTIDVELEVGEQVRIKSGPFANQVGEVQEIETDKFKLTVLVDMFGRETPVEVEFDQIE
KL
Download sequence
Identical sequences A0A0D1GN91 A0A0E0VM89 A0A0E1AHQ0 A0A0E1VUB0 A0A0E1X884 A0A0H2XEI4 A0A1E8X2W5 A0A2H5ALH8 P0A095 P0A096 P0A097 P0C1S3 Q2G0P2 Q5HID9 Q6GBV1 Q6GJD2 T1Y6G5 W8U699
gi|385780802|ref|YP_005756973.1| gi|537441955|ref|YP_008484532.1| gi|537460270|ref|YP_008490710.1| gi|545636946|ref|YP_008587122.1| gi|521211354|ref|YP_008167700.1| jgi|Aspzo1|146749|fgenesh1_pg.23_#_172 gi|470196604|ref|YP_007583005.1| gi|387601890|ref|YP_005733411.1| gi|161508776|ref|YP_001574435.1| gi|470190708|ref|YP_007577018.1| WP_001288302.1.100013 WP_001288302.1.100041 WP_001288302.1.100057 WP_001288302.1.10006 WP_001288302.1.100067 WP_001288302.1.100072 WP_001288302.1.100084 WP_001288302.1.100088 WP_001288302.1.100094 WP_001288302.1.100117 WP_001288302.1.100122 WP_001288302.1.10014 WP_001288302.1.100154 WP_001288302.1.100171 WP_001288302.1.100180 WP_001288302.1.100184 WP_001288302.1.100189 WP_001288302.1.100235 WP_001288302.1.100265 WP_001288302.1.100272 WP_001288302.1.100298 WP_001288302.1.100307 WP_001288302.1.100310 WP_001288302.1.10032 WP_001288302.1.100335 WP_001288302.1.100347 WP_001288302.1.100352 WP_001288302.1.100357 WP_001288302.1.100366 WP_001288302.1.100384 WP_001288302.1.100391 WP_001288302.1.100399 WP_001288302.1.10041 WP_001288302.1.100452 WP_001288302.1.10046 WP_001288302.1.100464 WP_001288302.1.10050 WP_001288302.1.10053 WP_001288302.1.100534 WP_001288302.1.100535 WP_001288302.1.100551 WP_001288302.1.100562 WP_001288302.1.100582 WP_001288302.1.100596 WP_001288302.1.100618 WP_001288302.1.100631 WP_001288302.1.100647 WP_001288302.1.100665 WP_001288302.1.100668 WP_001288302.1.100678 WP_001288302.1.100693 WP_001288302.1.100699 WP_001288302.1.100704 WP_001288302.1.100719 WP_001288302.1.100726 WP_001288302.1.100761 WP_001288302.1.100768 WP_001288302.1.100823 WP_001288302.1.100832 WP_001288302.1.100834 WP_001288302.1.10085 WP_001288302.1.100860 WP_001288302.1.100888 WP_001288302.1.100903 WP_001288302.1.100920 WP_001288302.1.100922 WP_001288302.1.100934 WP_001288302.1.100963 WP_001288302.1.10097 WP_001288302.1.100981 WP_001288302.1.100987 WP_001288302.1.101002 WP_001288302.1.101017 WP_001288302.1.101019 WP_001288302.1.101027 WP_001288302.1.101055 WP_001288302.1.101058 WP_001288302.1.101068 WP_001288302.1.101071 WP_001288302.1.101072 WP_001288302.1.101084 WP_001288302.1.101103 WP_001288302.1.10111 WP_001288302.1.101142 WP_001288302.1.101160 WP_001288302.1.101177 WP_001288302.1.101192 WP_001288302.1.101217 WP_001288302.1.101262 WP_001288302.1.101266 WP_001288302.1.101298 WP_001288302.1.101327 WP_001288302.1.101329 WP_001288302.1.101330 WP_001288302.1.101352 WP_001288302.1.101375 WP_001288302.1.101379 WP_001288302.1.101393 WP_001288302.1.101397 WP_001288302.1.101406 WP_001288302.1.101414 WP_001288302.1.101440 WP_001288302.1.101441 WP_001288302.1.101458 WP_001288302.1.10148 WP_001288302.1.101490 WP_001288302.1.101495 WP_001288302.1.101505 WP_001288302.1.101511 WP_001288302.1.101531 WP_001288302.1.101566 WP_001288302.1.101567 WP_001288302.1.101570 WP_001288302.1.101598 WP_001288302.1.101615 WP_001288302.1.101617 WP_001288302.1.101645 WP_001288302.1.10165 WP_001288302.1.10166 WP_001288302.1.101661 WP_001288302.1.101670 WP_001288302.1.101691 WP_001288302.1.101704 WP_001288302.1.101725 WP_001288302.1.101728 WP_001288302.1.101745 WP_001288302.1.101757 WP_001288302.1.101758 WP_001288302.1.101775 WP_001288302.1.101778 WP_001288302.1.101788 WP_001288302.1.101813 WP_001288302.1.101820 WP_001288302.1.101821 WP_001288302.1.101825 WP_001288302.1.101852 WP_001288302.1.101902 WP_001288302.1.101906 WP_001288302.1.101922 WP_001288302.1.101943 WP_001288302.1.101950 WP_001288302.1.101999 WP_001288302.1.102064 WP_001288302.1.102065 WP_001288302.1.102066 WP_001288302.1.102070 WP_001288302.1.102084 WP_001288302.1.10209 WP_001288302.1.102096 WP_001288302.1.102123 WP_001288302.1.102126 WP_001288302.1.102130 WP_001288302.1.102132 WP_001288302.1.1022 WP_001288302.1.10232 WP_001288302.1.10238 WP_001288302.1.1025 WP_001288302.1.10274 WP_001288302.1.10301 WP_001288302.1.10306 WP_001288302.1.10308 WP_001288302.1.1031 WP_001288302.1.1032 WP_001288302.1.10343 WP_001288302.1.10355 WP_001288302.1.10358 WP_001288302.1.10397 WP_001288302.1.10408 WP_001288302.1.1043 WP_001288302.1.10431 WP_001288302.1.10436 WP_001288302.1.10469 WP_001288302.1.10478 WP_001288302.1.10481 WP_001288302.1.10486 WP_001288302.1.10503 WP_001288302.1.1052 WP_001288302.1.10526 WP_001288302.1.10542 WP_001288302.1.10543 WP_001288302.1.10565 WP_001288302.1.10583 WP_001288302.1.1060 WP_001288302.1.10614 WP_001288302.1.10617 WP_001288302.1.10624 WP_001288302.1.10644 WP_001288302.1.10679 WP_001288302.1.10707 WP_001288302.1.10726 WP_001288302.1.10742 WP_001288302.1.10749 WP_001288302.1.10751 WP_001288302.1.1077 WP_001288302.1.10783 WP_001288302.1.10785 WP_001288302.1.10823 WP_001288302.1.10841 WP_001288302.1.10843 WP_001288302.1.10858 WP_001288302.1.1087 WP_001288302.1.10919 WP_001288302.1.10928 WP_001288302.1.10942 WP_001288302.1.10950 WP_001288302.1.10969 WP_001288302.1.1097 WP_001288302.1.10976 WP_001288302.1.10979 WP_001288302.1.10985 WP_001288302.1.11001 WP_001288302.1.11067 WP_001288302.1.11069 WP_001288302.1.11073 WP_001288302.1.11076 WP_001288302.1.11083 WP_001288302.1.11084 WP_001288302.1.11129 WP_001288302.1.1115 WP_001288302.1.11162 WP_001288302.1.11188 WP_001288302.1.1120 WP_001288302.1.11220 WP_001288302.1.11223 WP_001288302.1.11228 WP_001288302.1.11234 WP_001288302.1.1124 WP_001288302.1.11261 WP_001288302.1.11281 WP_001288302.1.11282 WP_001288302.1.11286 WP_001288302.1.11287 WP_001288302.1.11294 WP_001288302.1.11312 WP_001288302.1.11322 WP_001288302.1.11333 WP_001288302.1.11348 WP_001288302.1.11353 WP_001288302.1.1136 WP_001288302.1.11377 WP_001288302.1.11378 WP_001288302.1.11403 WP_001288302.1.11407 WP_001288302.1.11447 WP_001288302.1.11451 WP_001288302.1.11463 WP_001288302.1.1147 WP_001288302.1.11475 WP_001288302.1.11488 WP_001288302.1.11492 WP_001288302.1.11494 WP_001288302.1.11504 WP_001288302.1.11513 WP_001288302.1.11556 WP_001288302.1.11558 WP_001288302.1.11571 WP_001288302.1.11592 WP_001288302.1.11611 WP_001288302.1.11625 WP_001288302.1.11640 WP_001288302.1.11646 WP_001288302.1.11655 WP_001288302.1.11660 WP_001288302.1.11663 WP_001288302.1.11665 WP_001288302.1.11692 WP_001288302.1.117 WP_001288302.1.1171 WP_001288302.1.11719 WP_001288302.1.11720 WP_001288302.1.11730 WP_001288302.1.11736 WP_001288302.1.11741 WP_001288302.1.11768 WP_001288302.1.11781 WP_001288302.1.11795 WP_001288302.1.11816 WP_001288302.1.11828 WP_001288302.1.11829 WP_001288302.1.11837 WP_001288302.1.11884 WP_001288302.1.11894 WP_001288302.1.11903 WP_001288302.1.11919 WP_001288302.1.11969 WP_001288302.1.11991 WP_001288302.1.12005 WP_001288302.1.12019 WP_001288302.1.12042 WP_001288302.1.1205 WP_001288302.1.12073 WP_001288302.1.12098 WP_001288302.1.1210 WP_001288302.1.12123 WP_001288302.1.12137 WP_001288302.1.12149 WP_001288302.1.12152 WP_001288302.1.12158 WP_001288302.1.12170 WP_001288302.1.12175 WP_001288302.1.12179 WP_001288302.1.12181 WP_001288302.1.12194 WP_001288302.1.12226 WP_001288302.1.12233 WP_001288302.1.12234 WP_001288302.1.12256 WP_001288302.1.12272 WP_001288302.1.12297 WP_001288302.1.12328 WP_001288302.1.12330 WP_001288302.1.12361 WP_001288302.1.12366 WP_001288302.1.12391 WP_001288302.1.12436 WP_001288302.1.12437 WP_001288302.1.12447 WP_001288302.1.12498 WP_001288302.1.12508 WP_001288302.1.1252 WP_001288302.1.1253 WP_001288302.1.12555 WP_001288302.1.1257 WP_001288302.1.12597 WP_001288302.1.12598 WP_001288302.1.12605 WP_001288302.1.12608 WP_001288302.1.12618 WP_001288302.1.12639 WP_001288302.1.12668 WP_001288302.1.12685 WP_001288302.1.12705 WP_001288302.1.12707 WP_001288302.1.12715 WP_001288302.1.12733 WP_001288302.1.12737 WP_001288302.1.12770 WP_001288302.1.12771 WP_001288302.1.12780 WP_001288302.1.12788 WP_001288302.1.12802 WP_001288302.1.12822 WP_001288302.1.12829 WP_001288302.1.12833 WP_001288302.1.12845 WP_001288302.1.12858 WP_001288302.1.12862 WP_001288302.1.12884 WP_001288302.1.12903 WP_001288302.1.12904 WP_001288302.1.12918 WP_001288302.1.12920 WP_001288302.1.12937 WP_001288302.1.12938 WP_001288302.1.12951 WP_001288302.1.12977 WP_001288302.1.13013 WP_001288302.1.13039 WP_001288302.1.13062 WP_001288302.1.13072 WP_001288302.1.13091 WP_001288302.1.13104 WP_001288302.1.13112 WP_001288302.1.13154 WP_001288302.1.13164 WP_001288302.1.13169 WP_001288302.1.13170 WP_001288302.1.13189 WP_001288302.1.13228 WP_001288302.1.13243 WP_001288302.1.13250 WP_001288302.1.13303 WP_001288302.1.13307 WP_001288302.1.13317 WP_001288302.1.13322 WP_001288302.1.13326 WP_001288302.1.13336 WP_001288302.1.13355 WP_001288302.1.13366 WP_001288302.1.13376 WP_001288302.1.13379 WP_001288302.1.13381 WP_001288302.1.13405 WP_001288302.1.13448 WP_001288302.1.13468 WP_001288302.1.1347 WP_001288302.1.13486 WP_001288302.1.13505 WP_001288302.1.13514 WP_001288302.1.13531 WP_001288302.1.1355 WP_001288302.1.13554 WP_001288302.1.13556 WP_001288302.1.13568 WP_001288302.1.13598 WP_001288302.1.13612 WP_001288302.1.13617 WP_001288302.1.13650 WP_001288302.1.13654 WP_001288302.1.13665 WP_001288302.1.13668 WP_001288302.1.13670 WP_001288302.1.13680 WP_001288302.1.13683 WP_001288302.1.13709 WP_001288302.1.13726 WP_001288302.1.13727 WP_001288302.1.13728 WP_001288302.1.13733 WP_001288302.1.1374 WP_001288302.1.13755 WP_001288302.1.13757 WP_001288302.1.13769 WP_001288302.1.13772 WP_001288302.1.13787 WP_001288302.1.13804 WP_001288302.1.13805 WP_001288302.1.13807 WP_001288302.1.13870 WP_001288302.1.13879 WP_001288302.1.13884 WP_001288302.1.13897 WP_001288302.1.13914 WP_001288302.1.13933 WP_001288302.1.13940 WP_001288302.1.13948 WP_001288302.1.13983 WP_001288302.1.13986 WP_001288302.1.13987 WP_001288302.1.14010 WP_001288302.1.14025 WP_001288302.1.14071 WP_001288302.1.14076 WP_001288302.1.14097 WP_001288302.1.14112 WP_001288302.1.14143 WP_001288302.1.14153 WP_001288302.1.14163 WP_001288302.1.1418 WP_001288302.1.1420 WP_001288302.1.14201 WP_001288302.1.14221 WP_001288302.1.14233 WP_001288302.1.1425 WP_001288302.1.1426 WP_001288302.1.14272 WP_001288302.1.14281 WP_001288302.1.1429 WP_001288302.1.14298 WP_001288302.1.14305 WP_001288302.1.14314 WP_001288302.1.14337 WP_001288302.1.14342 WP_001288302.1.14349 WP_001288302.1.14358 WP_001288302.1.14363 WP_001288302.1.14364 WP_001288302.1.14365 WP_001288302.1.14366 WP_001288302.1.14394 WP_001288302.1.14397 WP_001288302.1.14412 WP_001288302.1.14418 WP_001288302.1.14475 WP_001288302.1.14535 WP_001288302.1.14546 WP_001288302.1.1457 WP_001288302.1.14577 WP_001288302.1.14590 WP_001288302.1.14596 WP_001288302.1.14639 WP_001288302.1.14665 WP_001288302.1.14666 WP_001288302.1.1468 WP_001288302.1.14681 WP_001288302.1.147 WP_001288302.1.1471 WP_001288302.1.14729 WP_001288302.1.14734 WP_001288302.1.14744 WP_001288302.1.14747 WP_001288302.1.1477 WP_001288302.1.14770 WP_001288302.1.14774 WP_001288302.1.14782 WP_001288302.1.14790 WP_001288302.1.14809 WP_001288302.1.14825 WP_001288302.1.14846 WP_001288302.1.14868 WP_001288302.1.14874 WP_001288302.1.14888 WP_001288302.1.1490 WP_001288302.1.14902 WP_001288302.1.14967 WP_001288302.1.14970 WP_001288302.1.14987 WP_001288302.1.15000 WP_001288302.1.15015 WP_001288302.1.15029 WP_001288302.1.15071 WP_001288302.1.15091 WP_001288302.1.15098 WP_001288302.1.15108 WP_001288302.1.15150 WP_001288302.1.15173 WP_001288302.1.15185 WP_001288302.1.1520 WP_001288302.1.15201 WP_001288302.1.15206 WP_001288302.1.15228 WP_001288302.1.15241 WP_001288302.1.1525 WP_001288302.1.15255 WP_001288302.1.15263 WP_001288302.1.15268 WP_001288302.1.15269 WP_001288302.1.15278 WP_001288302.1.15294 WP_001288302.1.15296 WP_001288302.1.15329 WP_001288302.1.15389 WP_001288302.1.15399 WP_001288302.1.15403 WP_001288302.1.15409 WP_001288302.1.15421 WP_001288302.1.15438 WP_001288302.1.1545 WP_001288302.1.15478 WP_001288302.1.15489 WP_001288302.1.15505 WP_001288302.1.15507 WP_001288302.1.15524 WP_001288302.1.15532 WP_001288302.1.15533 WP_001288302.1.15544 WP_001288302.1.15546 WP_001288302.1.15572 WP_001288302.1.1558 WP_001288302.1.15590 WP_001288302.1.15591 WP_001288302.1.15601 WP_001288302.1.1564 WP_001288302.1.15641 WP_001288302.1.15679 WP_001288302.1.15687 WP_001288302.1.1569 WP_001288302.1.15691 WP_001288302.1.15706 WP_001288302.1.15712 WP_001288302.1.15722 WP_001288302.1.15753 WP_001288302.1.15785 WP_001288302.1.1579 WP_001288302.1.15812 WP_001288302.1.15818 WP_001288302.1.15819 WP_001288302.1.1583 WP_001288302.1.15838 WP_001288302.1.1586 WP_001288302.1.15883 WP_001288302.1.15888 WP_001288302.1.15892 WP_001288302.1.15897 WP_001288302.1.15898 WP_001288302.1.159 WP_001288302.1.15920 WP_001288302.1.15921 WP_001288302.1.15925 WP_001288302.1.15928 WP_001288302.1.15939 WP_001288302.1.15948 WP_001288302.1.15957 WP_001288302.1.1600 WP_001288302.1.16018 WP_001288302.1.16026 WP_001288302.1.1606 WP_001288302.1.16068 WP_001288302.1.16083 WP_001288302.1.16096 WP_001288302.1.16098 WP_001288302.1.16112 WP_001288302.1.16114 WP_001288302.1.16140 WP_001288302.1.16157 WP_001288302.1.16173 WP_001288302.1.16195 WP_001288302.1.16203 WP_001288302.1.16213 WP_001288302.1.16214 WP_001288302.1.1623 WP_001288302.1.16237 WP_001288302.1.16251 WP_001288302.1.16265 WP_001288302.1.16276 WP_001288302.1.16311 WP_001288302.1.16362 WP_001288302.1.16372 WP_001288302.1.16395 WP_001288302.1.16399 WP_001288302.1.16407 WP_001288302.1.16408 WP_001288302.1.16414 WP_001288302.1.16417 WP_001288302.1.16436 WP_001288302.1.16455 WP_001288302.1.16458 WP_001288302.1.16467 WP_001288302.1.16478 WP_001288302.1.16554 WP_001288302.1.16564 WP_001288302.1.16569 WP_001288302.1.16589 WP_001288302.1.16603 WP_001288302.1.16617 WP_001288302.1.16628 WP_001288302.1.16632 WP_001288302.1.16639 WP_001288302.1.1665 WP_001288302.1.16651 WP_001288302.1.16653 WP_001288302.1.1666 WP_001288302.1.16672 WP_001288302.1.16679 WP_001288302.1.16688 WP_001288302.1.16693 WP_001288302.1.16703 WP_001288302.1.16747 WP_001288302.1.16757 WP_001288302.1.16761 WP_001288302.1.16768 WP_001288302.1.16770 WP_001288302.1.16776 WP_001288302.1.16794 WP_001288302.1.16802 WP_001288302.1.16815 WP_001288302.1.16824 WP_001288302.1.16880 WP_001288302.1.16882 WP_001288302.1.16892 WP_001288302.1.16920 WP_001288302.1.16925 WP_001288302.1.16946 WP_001288302.1.16969 WP_001288302.1.16986 WP_001288302.1.170 WP_001288302.1.17009 WP_001288302.1.17012 WP_001288302.1.17038 WP_001288302.1.17046 WP_001288302.1.17050 WP_001288302.1.17080 WP_001288302.1.17104 WP_001288302.1.17122 WP_001288302.1.17132 WP_001288302.1.17137 WP_001288302.1.17139 WP_001288302.1.17143 WP_001288302.1.17156 WP_001288302.1.17157 WP_001288302.1.17169 WP_001288302.1.17176 WP_001288302.1.17180 WP_001288302.1.17201 WP_001288302.1.17210 WP_001288302.1.17231 WP_001288302.1.17234 WP_001288302.1.17249 WP_001288302.1.1725 WP_001288302.1.17256 WP_001288302.1.17289 WP_001288302.1.1729 WP_001288302.1.17296 WP_001288302.1.17309 WP_001288302.1.17320 WP_001288302.1.17327 WP_001288302.1.1736 WP_001288302.1.1740 WP_001288302.1.1741 WP_001288302.1.17419 WP_001288302.1.17450 WP_001288302.1.17454 WP_001288302.1.17456 WP_001288302.1.17485 WP_001288302.1.1751 WP_001288302.1.17520 WP_001288302.1.17524 WP_001288302.1.17529 WP_001288302.1.17531 WP_001288302.1.1756 WP_001288302.1.17569 WP_001288302.1.17581 WP_001288302.1.17590 WP_001288302.1.17643 WP_001288302.1.1765 WP_001288302.1.17650 WP_001288302.1.17657 WP_001288302.1.17666 WP_001288302.1.17671 WP_001288302.1.17676 WP_001288302.1.17717 WP_001288302.1.17718 WP_001288302.1.17725 WP_001288302.1.17729 WP_001288302.1.17737 WP_001288302.1.17770 WP_001288302.1.17796 WP_001288302.1.17818 WP_001288302.1.17832 WP_001288302.1.17834 WP_001288302.1.17845 WP_001288302.1.17847 WP_001288302.1.17853 WP_001288302.1.17859 WP_001288302.1.17876 WP_001288302.1.17909 WP_001288302.1.17922 WP_001288302.1.17928 WP_001288302.1.17929 WP_001288302.1.17943 WP_001288302.1.17951 WP_001288302.1.17974 WP_001288302.1.17987 WP_001288302.1.18011 WP_001288302.1.18016 WP_001288302.1.18035 WP_001288302.1.18043 WP_001288302.1.18069 WP_001288302.1.18074 WP_001288302.1.18080 WP_001288302.1.18105 WP_001288302.1.1811 WP_001288302.1.18113 WP_001288302.1.18132 WP_001288302.1.18140 WP_001288302.1.18153 WP_001288302.1.18197 WP_001288302.1.18203 WP_001288302.1.18205 WP_001288302.1.18237 WP_001288302.1.18248 WP_001288302.1.18261 WP_001288302.1.18273 WP_001288302.1.18283 WP_001288302.1.18288 WP_001288302.1.1829 WP_001288302.1.18290 WP_001288302.1.18301 WP_001288302.1.18309 WP_001288302.1.18310 WP_001288302.1.18320 WP_001288302.1.18346 WP_001288302.1.1835 WP_001288302.1.18360 WP_001288302.1.18412 WP_001288302.1.18424 WP_001288302.1.18429 WP_001288302.1.18437 WP_001288302.1.18451 WP_001288302.1.1847 WP_001288302.1.18487 WP_001288302.1.1849 WP_001288302.1.18495 WP_001288302.1.185 WP_001288302.1.18506 WP_001288302.1.18507 WP_001288302.1.1851 WP_001288302.1.18516 WP_001288302.1.18526 WP_001288302.1.18527 WP_001288302.1.18529 WP_001288302.1.18538 WP_001288302.1.18539 WP_001288302.1.18560 WP_001288302.1.18562 WP_001288302.1.18567 WP_001288302.1.18570 WP_001288302.1.18590 WP_001288302.1.18591 WP_001288302.1.18605 WP_001288302.1.18611 WP_001288302.1.18627 WP_001288302.1.18632 WP_001288302.1.18656 WP_001288302.1.18658 WP_001288302.1.18668 WP_001288302.1.18679 WP_001288302.1.18719 WP_001288302.1.18741 WP_001288302.1.18758 WP_001288302.1.18777 WP_001288302.1.18792 WP_001288302.1.18799 WP_001288302.1.18809 WP_001288302.1.18818 WP_001288302.1.18819 WP_001288302.1.18830 WP_001288302.1.18834 WP_001288302.1.18836 WP_001288302.1.18870 WP_001288302.1.18879 WP_001288302.1.18882 WP_001288302.1.18918 WP_001288302.1.1892 WP_001288302.1.18938 WP_001288302.1.18963 WP_001288302.1.18965 WP_001288302.1.18968 WP_001288302.1.18974 WP_001288302.1.18987 WP_001288302.1.18996 WP_001288302.1.19009 WP_001288302.1.1901 WP_001288302.1.19014 WP_001288302.1.19022 WP_001288302.1.19027 WP_001288302.1.19052 WP_001288302.1.19082 WP_001288302.1.19102 WP_001288302.1.19109 WP_001288302.1.1911 WP_001288302.1.19149 WP_001288302.1.19179 WP_001288302.1.192 WP_001288302.1.1921 WP_001288302.1.19259 WP_001288302.1.19272 WP_001288302.1.19301 WP_001288302.1.19306 WP_001288302.1.19322 WP_001288302.1.19370 WP_001288302.1.19375 WP_001288302.1.19377 WP_001288302.1.19390 WP_001288302.1.19399 WP_001288302.1.1940 WP_001288302.1.19411 WP_001288302.1.1943 WP_001288302.1.19430 WP_001288302.1.19444 WP_001288302.1.19497 WP_001288302.1.19509 WP_001288302.1.19537 WP_001288302.1.19555 WP_001288302.1.19575 WP_001288302.1.19577 WP_001288302.1.19611 WP_001288302.1.1962 WP_001288302.1.1964 WP_001288302.1.19643 WP_001288302.1.19700 WP_001288302.1.19701 WP_001288302.1.19725 WP_001288302.1.19732 WP_001288302.1.19733 WP_001288302.1.1974 WP_001288302.1.19748 WP_001288302.1.1975 WP_001288302.1.19759 WP_001288302.1.19765 WP_001288302.1.19775 WP_001288302.1.19788 WP_001288302.1.19792 WP_001288302.1.19807 WP_001288302.1.19816 WP_001288302.1.19848 WP_001288302.1.19853 WP_001288302.1.19881 WP_001288302.1.19891 WP_001288302.1.19912 WP_001288302.1.19921 WP_001288302.1.19928 WP_001288302.1.19977 WP_001288302.1.19980 WP_001288302.1.19981 WP_001288302.1.19982 WP_001288302.1.2 WP_001288302.1.20006 WP_001288302.1.20049 WP_001288302.1.20052 WP_001288302.1.20057 WP_001288302.1.2007 WP_001288302.1.20078 WP_001288302.1.2008 WP_001288302.1.20090 WP_001288302.1.20100 WP_001288302.1.20101 WP_001288302.1.2013 WP_001288302.1.20155 WP_001288302.1.20156 WP_001288302.1.20160 WP_001288302.1.20161 WP_001288302.1.20167 WP_001288302.1.20177 WP_001288302.1.20191 WP_001288302.1.20201 WP_001288302.1.20210 WP_001288302.1.20214 WP_001288302.1.20235 WP_001288302.1.20245 WP_001288302.1.20265 WP_001288302.1.2029 WP_001288302.1.20307 WP_001288302.1.20324 WP_001288302.1.20340 WP_001288302.1.20354 WP_001288302.1.20386 WP_001288302.1.20398 WP_001288302.1.20399 WP_001288302.1.20411 WP_001288302.1.20447 WP_001288302.1.20473 WP_001288302.1.20479 WP_001288302.1.20487 WP_001288302.1.20496 WP_001288302.1.20500 WP_001288302.1.20550 WP_001288302.1.20554 WP_001288302.1.20558 WP_001288302.1.20574 WP_001288302.1.20579 WP_001288302.1.20585 WP_001288302.1.20611 WP_001288302.1.20619 WP_001288302.1.20620 WP_001288302.1.20649 WP_001288302.1.20661 WP_001288302.1.20690 WP_001288302.1.20698 WP_001288302.1.20736 WP_001288302.1.20772 WP_001288302.1.2079 WP_001288302.1.20796 WP_001288302.1.20821 WP_001288302.1.20833 WP_001288302.1.20838 WP_001288302.1.20846 WP_001288302.1.20860 WP_001288302.1.20867 WP_001288302.1.20878 WP_001288302.1.20906 WP_001288302.1.20913 WP_001288302.1.20922 WP_001288302.1.20935 WP_001288302.1.20939 WP_001288302.1.20945 WP_001288302.1.20971 WP_001288302.1.20975 WP_001288302.1.20979 WP_001288302.1.21009 WP_001288302.1.21013 WP_001288302.1.21031 WP_001288302.1.21054 WP_001288302.1.21056 WP_001288302.1.21064 WP_001288302.1.21066 WP_001288302.1.21078 WP_001288302.1.21080 WP_001288302.1.21081 WP_001288302.1.21102 WP_001288302.1.21109 WP_001288302.1.21111 WP_001288302.1.21154 WP_001288302.1.21183 WP_001288302.1.2119 WP_001288302.1.21257 WP_001288302.1.21272 WP_001288302.1.2128 WP_001288302.1.2129 WP_001288302.1.21312 WP_001288302.1.21313 WP_001288302.1.21330 WP_001288302.1.21339 WP_001288302.1.2135 WP_001288302.1.21356 WP_001288302.1.21359 WP_001288302.1.21375 WP_001288302.1.21379 WP_001288302.1.21386 WP_001288302.1.21393 WP_001288302.1.21402 WP_001288302.1.21412 WP_001288302.1.21449 WP_001288302.1.21458 WP_001288302.1.21464 WP_001288302.1.21465 WP_001288302.1.21477 WP_001288302.1.21480 WP_001288302.1.21500 WP_001288302.1.21511 WP_001288302.1.21514 WP_001288302.1.2154 WP_001288302.1.21572 WP_001288302.1.21583 WP_001288302.1.2159 WP_001288302.1.2160 WP_001288302.1.21601 WP_001288302.1.21621 WP_001288302.1.21636 WP_001288302.1.21679 WP_001288302.1.21712 WP_001288302.1.21724 WP_001288302.1.21746 WP_001288302.1.21763 WP_001288302.1.2178 WP_001288302.1.21787 WP_001288302.1.21820 WP_001288302.1.21828 WP_001288302.1.21830 WP_001288302.1.21890 WP_001288302.1.21894 WP_001288302.1.21901 WP_001288302.1.21954 WP_001288302.1.21988 WP_001288302.1.22022 WP_001288302.1.22027 WP_001288302.1.22045 WP_001288302.1.22065 WP_001288302.1.22082 WP_001288302.1.22093 WP_001288302.1.2211 WP_001288302.1.22111 WP_001288302.1.22149 WP_001288302.1.22163 WP_001288302.1.22165 WP_001288302.1.22170 WP_001288302.1.22174 WP_001288302.1.22177 WP_001288302.1.22180 WP_001288302.1.22197 WP_001288302.1.22200 WP_001288302.1.22227 WP_001288302.1.22246 WP_001288302.1.22259 WP_001288302.1.22302 WP_001288302.1.22307 WP_001288302.1.22344 WP_001288302.1.22351 WP_001288302.1.22367 WP_001288302.1.22369 WP_001288302.1.22400 WP_001288302.1.22418 WP_001288302.1.22493 WP_001288302.1.22512 WP_001288302.1.22526 WP_001288302.1.22531 WP_001288302.1.22533 WP_001288302.1.22547 WP_001288302.1.22551 WP_001288302.1.22559 WP_001288302.1.22650 WP_001288302.1.22657 WP_001288302.1.22684 WP_001288302.1.22696 WP_001288302.1.22702 WP_001288302.1.22709 WP_001288302.1.22714 WP_001288302.1.22727 WP_001288302.1.22730 WP_001288302.1.22731 WP_001288302.1.22738 WP_001288302.1.22739 WP_001288302.1.22787 WP_001288302.1.22789 WP_001288302.1.22790 WP_001288302.1.22792 WP_001288302.1.2280 WP_001288302.1.22803 WP_001288302.1.22808 WP_001288302.1.22811 WP_001288302.1.22843 WP_001288302.1.22853 WP_001288302.1.22859 WP_001288302.1.22861 WP_001288302.1.22869 WP_001288302.1.22890 WP_001288302.1.22924 WP_001288302.1.22969 WP_001288302.1.22975 WP_001288302.1.22994 WP_001288302.1.23004 WP_001288302.1.23008 WP_001288302.1.23048 WP_001288302.1.23061 WP_001288302.1.23069 WP_001288302.1.23082 WP_001288302.1.23103 WP_001288302.1.23121 WP_001288302.1.23130 WP_001288302.1.23132 WP_001288302.1.23133 WP_001288302.1.23152 WP_001288302.1.23161 WP_001288302.1.23185 WP_001288302.1.23194 WP_001288302.1.23197 WP_001288302.1.23217 WP_001288302.1.23222 WP_001288302.1.23228 WP_001288302.1.23238 WP_001288302.1.23244 WP_001288302.1.2327 WP_001288302.1.23275 WP_001288302.1.23288 WP_001288302.1.23381 WP_001288302.1.23413 WP_001288302.1.23420 WP_001288302.1.23431 WP_001288302.1.23439 WP_001288302.1.23449 WP_001288302.1.23450 WP_001288302.1.23476 WP_001288302.1.23489 WP_001288302.1.23516 WP_001288302.1.23531 WP_001288302.1.23541 WP_001288302.1.23544 WP_001288302.1.23557 WP_001288302.1.23568 WP_001288302.1.23572 WP_001288302.1.23580 WP_001288302.1.23586 WP_001288302.1.23613 WP_001288302.1.23617 WP_001288302.1.23626 WP_001288302.1.23630 WP_001288302.1.23644 WP_001288302.1.23690 WP_001288302.1.23710 WP_001288302.1.23740 WP_001288302.1.23796 WP_001288302.1.23809 WP_001288302.1.2382 WP_001288302.1.23822 WP_001288302.1.23842 WP_001288302.1.23849 WP_001288302.1.23856 WP_001288302.1.2389 WP_001288302.1.23896 WP_001288302.1.23900 WP_001288302.1.23902 WP_001288302.1.23907 WP_001288302.1.23935 WP_001288302.1.23944 WP_001288302.1.23956 WP_001288302.1.23972 WP_001288302.1.23995 WP_001288302.1.23998 WP_001288302.1.24000 WP_001288302.1.24129 WP_001288302.1.24148 WP_001288302.1.24167 WP_001288302.1.24174 WP_001288302.1.2420 WP_001288302.1.24207 WP_001288302.1.24213 WP_001288302.1.2423 WP_001288302.1.24241 WP_001288302.1.24263 WP_001288302.1.2427 WP_001288302.1.24275 WP_001288302.1.24277 WP_001288302.1.24279 WP_001288302.1.2434 WP_001288302.1.24343 WP_001288302.1.24347 WP_001288302.1.24364 WP_001288302.1.24388 WP_001288302.1.24416 WP_001288302.1.24418 WP_001288302.1.2442 WP_001288302.1.24436 WP_001288302.1.24437 WP_001288302.1.24439 WP_001288302.1.24443 WP_001288302.1.24462 WP_001288302.1.24469 WP_001288302.1.24478 WP_001288302.1.24502 WP_001288302.1.24503 WP_001288302.1.24519 WP_001288302.1.2458 WP_001288302.1.24589 WP_001288302.1.24596 WP_001288302.1.24597 WP_001288302.1.24602 WP_001288302.1.24617 WP_001288302.1.24631 WP_001288302.1.24644 WP_001288302.1.24679 WP_001288302.1.24681 WP_001288302.1.24684 WP_001288302.1.24685 WP_001288302.1.24702 WP_001288302.1.24745 WP_001288302.1.24780 WP_001288302.1.24781 WP_001288302.1.2480 WP_001288302.1.24802 WP_001288302.1.24817 WP_001288302.1.24823 WP_001288302.1.24855 WP_001288302.1.24856 WP_001288302.1.24891 WP_001288302.1.24903 WP_001288302.1.24918 WP_001288302.1.2497 WP_001288302.1.25007 WP_001288302.1.2501 WP_001288302.1.25012 WP_001288302.1.25029 WP_001288302.1.2506 WP_001288302.1.25070 WP_001288302.1.25083 WP_001288302.1.25092 WP_001288302.1.25095 WP_001288302.1.25098 WP_001288302.1.25115 WP_001288302.1.25117 WP_001288302.1.25120 WP_001288302.1.25145 WP_001288302.1.25167 WP_001288302.1.25170 WP_001288302.1.25187 WP_001288302.1.25209 WP_001288302.1.2522 WP_001288302.1.25262 WP_001288302.1.25287 WP_001288302.1.25331 WP_001288302.1.25361 WP_001288302.1.25433 WP_001288302.1.25438 WP_001288302.1.2544 WP_001288302.1.25459 WP_001288302.1.25469 WP_001288302.1.25479 WP_001288302.1.25488 WP_001288302.1.25489 WP_001288302.1.25495 WP_001288302.1.25511 WP_001288302.1.2552 WP_001288302.1.25557 WP_001288302.1.25567 WP_001288302.1.25591 WP_001288302.1.25593 WP_001288302.1.25595 WP_001288302.1.25597 WP_001288302.1.25621 WP_001288302.1.25623 WP_001288302.1.25633 WP_001288302.1.25634 WP_001288302.1.257 WP_001288302.1.25721 WP_001288302.1.25737 WP_001288302.1.25744 WP_001288302.1.25758 WP_001288302.1.25770 WP_001288302.1.25772 WP_001288302.1.25776 WP_001288302.1.25779 WP_001288302.1.2579 WP_001288302.1.25801 WP_001288302.1.25802 WP_001288302.1.25820 WP_001288302.1.25840 WP_001288302.1.25852 WP_001288302.1.25856 WP_001288302.1.25857 WP_001288302.1.25868 WP_001288302.1.25881 WP_001288302.1.25891 WP_001288302.1.2590 WP_001288302.1.25910 WP_001288302.1.2592 WP_001288302.1.25924 WP_001288302.1.2593 WP_001288302.1.25930 WP_001288302.1.25955 WP_001288302.1.25984 WP_001288302.1.26006 WP_001288302.1.26012 WP_001288302.1.26015 WP_001288302.1.26033 WP_001288302.1.26039 WP_001288302.1.2608 WP_001288302.1.26086 WP_001288302.1.26106 WP_001288302.1.26143 WP_001288302.1.26169 WP_001288302.1.26172 WP_001288302.1.2619 WP_001288302.1.262 WP_001288302.1.2621 WP_001288302.1.26225 WP_001288302.1.26226 WP_001288302.1.26255 WP_001288302.1.26266 WP_001288302.1.26276 WP_001288302.1.26289 WP_001288302.1.26290 WP_001288302.1.26293 WP_001288302.1.26298 WP_001288302.1.26306 WP_001288302.1.26307 WP_001288302.1.26314 WP_001288302.1.26315 WP_001288302.1.26318 WP_001288302.1.2633 WP_001288302.1.26340 WP_001288302.1.26345 WP_001288302.1.26346 WP_001288302.1.26354 WP_001288302.1.26359 WP_001288302.1.26364 WP_001288302.1.26370 WP_001288302.1.26397 WP_001288302.1.26399 WP_001288302.1.26404 WP_001288302.1.26424 WP_001288302.1.2643 WP_001288302.1.2645 WP_001288302.1.26481 WP_001288302.1.26506 WP_001288302.1.26555 WP_001288302.1.2656 WP_001288302.1.2658 WP_001288302.1.26584 WP_001288302.1.2661 WP_001288302.1.26626 WP_001288302.1.2664 WP_001288302.1.26650 WP_001288302.1.26662 WP_001288302.1.26663 WP_001288302.1.26677 WP_001288302.1.26692 WP_001288302.1.26713 WP_001288302.1.26726 WP_001288302.1.2673 WP_001288302.1.26733 WP_001288302.1.2674 WP_001288302.1.26749 WP_001288302.1.26751 WP_001288302.1.26771 WP_001288302.1.26772 WP_001288302.1.26790 WP_001288302.1.26804 WP_001288302.1.2684 WP_001288302.1.26840 WP_001288302.1.26850 WP_001288302.1.26865 WP_001288302.1.2687 WP_001288302.1.26884 WP_001288302.1.26886 WP_001288302.1.2689 WP_001288302.1.26903 WP_001288302.1.26905 WP_001288302.1.26927 WP_001288302.1.26929 WP_001288302.1.26938 WP_001288302.1.26944 WP_001288302.1.26947 WP_001288302.1.26958 WP_001288302.1.26963 WP_001288302.1.2697 WP_001288302.1.27013 WP_001288302.1.27053 WP_001288302.1.27080 WP_001288302.1.27083 WP_001288302.1.27097 WP_001288302.1.27120 WP_001288302.1.27127 WP_001288302.1.27154 WP_001288302.1.27166 WP_001288302.1.27168 WP_001288302.1.27170 WP_001288302.1.2718 WP_001288302.1.27182 WP_001288302.1.2719 WP_001288302.1.27199 WP_001288302.1.27207 WP_001288302.1.27246 WP_001288302.1.2725 WP_001288302.1.27262 WP_001288302.1.27293 WP_001288302.1.27294 WP_001288302.1.27303 WP_001288302.1.27311 WP_001288302.1.27323 WP_001288302.1.27333 WP_001288302.1.2734 WP_001288302.1.27345 WP_001288302.1.27379 WP_001288302.1.27415 WP_001288302.1.27447 WP_001288302.1.27448 WP_001288302.1.27455 WP_001288302.1.27456 WP_001288302.1.27457 WP_001288302.1.27467 WP_001288302.1.27468 WP_001288302.1.27516 WP_001288302.1.2753 WP_001288302.1.27539 WP_001288302.1.27551 WP_001288302.1.27562 WP_001288302.1.2759 WP_001288302.1.27590 WP_001288302.1.27608 WP_001288302.1.27614 WP_001288302.1.27615 WP_001288302.1.27621 WP_001288302.1.27622 WP_001288302.1.27628 WP_001288302.1.27640 WP_001288302.1.27646 WP_001288302.1.27654 WP_001288302.1.27662 WP_001288302.1.27667 WP_001288302.1.27670 WP_001288302.1.27673 WP_001288302.1.2768 WP_001288302.1.27689 WP_001288302.1.27696 WP_001288302.1.27717 WP_001288302.1.27720 WP_001288302.1.27739 WP_001288302.1.27744 WP_001288302.1.27748 WP_001288302.1.27765 WP_001288302.1.27787 WP_001288302.1.27793 WP_001288302.1.27799 WP_001288302.1.27817 WP_001288302.1.27830 WP_001288302.1.27834 WP_001288302.1.27854 WP_001288302.1.27929 WP_001288302.1.2795 WP_001288302.1.27950 WP_001288302.1.27953 WP_001288302.1.27972 WP_001288302.1.27999 WP_001288302.1.28007 WP_001288302.1.28016 WP_001288302.1.28025 WP_001288302.1.28063 WP_001288302.1.28071 WP_001288302.1.28079 WP_001288302.1.28081 WP_001288302.1.28088 WP_001288302.1.28091 WP_001288302.1.28105 WP_001288302.1.28107 WP_001288302.1.28117 WP_001288302.1.28138 WP_001288302.1.28147 WP_001288302.1.28158 WP_001288302.1.28173 WP_001288302.1.28191 WP_001288302.1.28207 WP_001288302.1.28213 WP_001288302.1.28226 WP_001288302.1.28230 WP_001288302.1.28253 WP_001288302.1.28257 WP_001288302.1.28274 WP_001288302.1.28298 WP_001288302.1.28315 WP_001288302.1.28319 WP_001288302.1.28334 WP_001288302.1.28347 WP_001288302.1.28358 WP_001288302.1.28360 WP_001288302.1.28376 WP_001288302.1.28381 WP_001288302.1.28388 WP_001288302.1.28399 WP_001288302.1.28400 WP_001288302.1.28426 WP_001288302.1.28430 WP_001288302.1.28447 WP_001288302.1.28477 WP_001288302.1.28482 WP_001288302.1.28498 WP_001288302.1.28501 WP_001288302.1.28502 WP_001288302.1.2852 WP_001288302.1.28526 WP_001288302.1.28527 WP_001288302.1.28532 WP_001288302.1.28564 WP_001288302.1.28578 WP_001288302.1.28580 WP_001288302.1.28584 WP_001288302.1.28605 WP_001288302.1.28614 WP_001288302.1.2862 WP_001288302.1.28629 WP_001288302.1.28650 WP_001288302.1.28652 WP_001288302.1.28672 WP_001288302.1.28675 WP_001288302.1.28690 WP_001288302.1.28691 WP_001288302.1.28710 WP_001288302.1.28720 WP_001288302.1.28763 WP_001288302.1.28784 WP_001288302.1.28785 WP_001288302.1.28848 WP_001288302.1.28862 WP_001288302.1.28866 WP_001288302.1.28871 WP_001288302.1.28874 WP_001288302.1.28887 WP_001288302.1.28909 WP_001288302.1.28915 WP_001288302.1.28925 WP_001288302.1.28933 WP_001288302.1.28934 WP_001288302.1.28960 WP_001288302.1.28970 WP_001288302.1.28981 WP_001288302.1.28987 WP_001288302.1.29014 WP_001288302.1.29052 WP_001288302.1.29060 WP_001288302.1.29090 WP_001288302.1.29107 WP_001288302.1.29112 WP_001288302.1.2913 WP_001288302.1.29155 WP_001288302.1.29166 WP_001288302.1.29170 WP_001288302.1.29187 WP_001288302.1.29188 WP_001288302.1.29207 WP_001288302.1.29226 WP_001288302.1.29242 WP_001288302.1.29243 WP_001288302.1.29244 WP_001288302.1.29250 WP_001288302.1.29263 WP_001288302.1.29272 WP_001288302.1.29276 WP_001288302.1.29282 WP_001288302.1.29285 WP_001288302.1.29301 WP_001288302.1.29312 WP_001288302.1.29315 WP_001288302.1.29329 WP_001288302.1.29366 WP_001288302.1.29368 WP_001288302.1.29372 WP_001288302.1.29373 WP_001288302.1.29381 WP_001288302.1.29395 WP_001288302.1.29420 WP_001288302.1.29445 WP_001288302.1.29468 WP_001288302.1.29511 WP_001288302.1.29522 WP_001288302.1.29554 WP_001288302.1.29557 WP_001288302.1.29561 WP_001288302.1.2957 WP_001288302.1.29596 WP_001288302.1.29644 WP_001288302.1.29676 WP_001288302.1.29716 WP_001288302.1.2972 WP_001288302.1.29731 WP_001288302.1.29736 WP_001288302.1.29744 WP_001288302.1.2975 WP_001288302.1.29758 WP_001288302.1.29781 WP_001288302.1.29788 WP_001288302.1.29805 WP_001288302.1.2981 WP_001288302.1.29826 WP_001288302.1.2983 WP_001288302.1.29862 WP_001288302.1.29885 WP_001288302.1.29902 WP_001288302.1.29905 WP_001288302.1.29918 WP_001288302.1.29956 WP_001288302.1.29963 WP_001288302.1.2997 WP_001288302.1.29981 WP_001288302.1.29982 WP_001288302.1.30012 WP_001288302.1.30023 WP_001288302.1.30033 WP_001288302.1.30047 WP_001288302.1.30051 WP_001288302.1.30057 WP_001288302.1.30089 WP_001288302.1.30095 WP_001288302.1.30100 WP_001288302.1.30115 WP_001288302.1.30130 WP_001288302.1.30150 WP_001288302.1.30152 WP_001288302.1.30154 WP_001288302.1.30176 WP_001288302.1.30186 WP_001288302.1.30188 WP_001288302.1.30190 WP_001288302.1.30191 WP_001288302.1.30197 WP_001288302.1.30204 WP_001288302.1.30209 WP_001288302.1.30249 WP_001288302.1.30262 WP_001288302.1.30268 WP_001288302.1.30274 WP_001288302.1.3029 WP_001288302.1.30294 WP_001288302.1.30302 WP_001288302.1.30307 WP_001288302.1.30328 WP_001288302.1.30333 WP_001288302.1.30350 WP_001288302.1.30364 WP_001288302.1.30367 WP_001288302.1.30376 WP_001288302.1.30381 WP_001288302.1.30385 WP_001288302.1.30418 WP_001288302.1.30422 WP_001288302.1.30458 WP_001288302.1.30477 WP_001288302.1.30496 WP_001288302.1.30508 WP_001288302.1.30530 WP_001288302.1.30531 WP_001288302.1.30560 WP_001288302.1.30566 WP_001288302.1.30568 WP_001288302.1.30622 WP_001288302.1.30623 WP_001288302.1.30645 WP_001288302.1.30646 WP_001288302.1.30648 WP_001288302.1.30650 WP_001288302.1.30652 WP_001288302.1.30666 WP_001288302.1.30690 WP_001288302.1.30702 WP_001288302.1.30720 WP_001288302.1.30726 WP_001288302.1.30758 WP_001288302.1.30763 WP_001288302.1.30768 WP_001288302.1.3077 WP_001288302.1.30779 WP_001288302.1.30845 WP_001288302.1.30846 WP_001288302.1.30847 WP_001288302.1.30854 WP_001288302.1.30861 WP_001288302.1.30862 WP_001288302.1.30863 WP_001288302.1.30874 WP_001288302.1.30878 WP_001288302.1.30880 WP_001288302.1.30889 WP_001288302.1.30907 WP_001288302.1.30911 WP_001288302.1.30915 WP_001288302.1.30916 WP_001288302.1.30928 WP_001288302.1.30945 WP_001288302.1.30962 WP_001288302.1.3097 WP_001288302.1.30970 WP_001288302.1.30971 WP_001288302.1.30998 WP_001288302.1.31005 WP_001288302.1.31022 WP_001288302.1.31037 WP_001288302.1.31039 WP_001288302.1.31041 WP_001288302.1.31048 WP_001288302.1.31065 WP_001288302.1.31068 WP_001288302.1.31077 WP_001288302.1.31091 WP_001288302.1.31113 WP_001288302.1.31114 WP_001288302.1.31120 WP_001288302.1.31124 WP_001288302.1.31176 WP_001288302.1.31194 WP_001288302.1.31202 WP_001288302.1.31204 WP_001288302.1.31206 WP_001288302.1.31212 WP_001288302.1.3123 WP_001288302.1.31232 WP_001288302.1.31278 WP_001288302.1.31315 WP_001288302.1.3132 WP_001288302.1.31337 WP_001288302.1.31339 WP_001288302.1.31355 WP_001288302.1.31363 WP_001288302.1.31376 WP_001288302.1.31377 WP_001288302.1.31426 WP_001288302.1.31436 WP_001288302.1.31437 WP_001288302.1.31441 WP_001288302.1.31442 WP_001288302.1.31462 WP_001288302.1.31468 WP_001288302.1.31478 WP_001288302.1.31479 WP_001288302.1.31497 WP_001288302.1.315 WP_001288302.1.31505 WP_001288302.1.31529 WP_001288302.1.31539 WP_001288302.1.31567 WP_001288302.1.31568 WP_001288302.1.31589 WP_001288302.1.31605 WP_001288302.1.31611 WP_001288302.1.31621 WP_001288302.1.31638 WP_001288302.1.31642 WP_001288302.1.31647 WP_001288302.1.31653 WP_001288302.1.31667 WP_001288302.1.31686 WP_001288302.1.31701 WP_001288302.1.31743 WP_001288302.1.31753 WP_001288302.1.31787 WP_001288302.1.31791 WP_001288302.1.31797 WP_001288302.1.31816 WP_001288302.1.31817 WP_001288302.1.31827 WP_001288302.1.31828 WP_001288302.1.31842 WP_001288302.1.3188 WP_001288302.1.31892 WP_001288302.1.31897 WP_001288302.1.31925 WP_001288302.1.31931 WP_001288302.1.31943 WP_001288302.1.31949 WP_001288302.1.31990 WP_001288302.1.31994 WP_001288302.1.31997 WP_001288302.1.32003 WP_001288302.1.32005 WP_001288302.1.32029 WP_001288302.1.32040 WP_001288302.1.32059 WP_001288302.1.32067 WP_001288302.1.32077 WP_001288302.1.32095 WP_001288302.1.32106 WP_001288302.1.32118 WP_001288302.1.32122 WP_001288302.1.32125 WP_001288302.1.32130 WP_001288302.1.32160 WP_001288302.1.32167 WP_001288302.1.3219 WP_001288302.1.32207 WP_001288302.1.32215 WP_001288302.1.32217 WP_001288302.1.32244 WP_001288302.1.32248 WP_001288302.1.32269 WP_001288302.1.32281 WP_001288302.1.3229 WP_001288302.1.32295 WP_001288302.1.32301 WP_001288302.1.3231 WP_001288302.1.32339 WP_001288302.1.32348 WP_001288302.1.32365 WP_001288302.1.32384 WP_001288302.1.32405 WP_001288302.1.3242 WP_001288302.1.3244 WP_001288302.1.32454 WP_001288302.1.32464 WP_001288302.1.32474 WP_001288302.1.32481 WP_001288302.1.32483 WP_001288302.1.32497 WP_001288302.1.32514 WP_001288302.1.32517 WP_001288302.1.32534 WP_001288302.1.32546 WP_001288302.1.32555 WP_001288302.1.32565 WP_001288302.1.32588 WP_001288302.1.32599 WP_001288302.1.32607 WP_001288302.1.32634 WP_001288302.1.32645 WP_001288302.1.32739 WP_001288302.1.32746 WP_001288302.1.32761 WP_001288302.1.32763 WP_001288302.1.32764 WP_001288302.1.32770 WP_001288302.1.32800 WP_001288302.1.32829 WP_001288302.1.32839 WP_001288302.1.32898 WP_001288302.1.32921 WP_001288302.1.32928 WP_001288302.1.3293 WP_001288302.1.32939 WP_001288302.1.32954 WP_001288302.1.32965 WP_001288302.1.32987 WP_001288302.1.3299 WP_001288302.1.33029 WP_001288302.1.33038 WP_001288302.1.33048 WP_001288302.1.3306 WP_001288302.1.33067 WP_001288302.1.33108 WP_001288302.1.33110 WP_001288302.1.33123 WP_001288302.1.33138 WP_001288302.1.33147 WP_001288302.1.3316 WP_001288302.1.33172 WP_001288302.1.33212 WP_001288302.1.33213 WP_001288302.1.33250 WP_001288302.1.33252 WP_001288302.1.33255 WP_001288302.1.33266 WP_001288302.1.33277 WP_001288302.1.33292 WP_001288302.1.33296 WP_001288302.1.3330 WP_001288302.1.33307 WP_001288302.1.33322 WP_001288302.1.33328 WP_001288302.1.33335 WP_001288302.1.3335 WP_001288302.1.33350 WP_001288302.1.33357 WP_001288302.1.33372 WP_001288302.1.3338 WP_001288302.1.33388 WP_001288302.1.33394 WP_001288302.1.3341 WP_001288302.1.33416 WP_001288302.1.3342 WP_001288302.1.33426 WP_001288302.1.3343 WP_001288302.1.33432 WP_001288302.1.3345 WP_001288302.1.33463 WP_001288302.1.33468 WP_001288302.1.3347 WP_001288302.1.33483 WP_001288302.1.33484 WP_001288302.1.33507 WP_001288302.1.33520 WP_001288302.1.33538 WP_001288302.1.33567 WP_001288302.1.33575 WP_001288302.1.3358 WP_001288302.1.33594 WP_001288302.1.33607 WP_001288302.1.33610 WP_001288302.1.33626 WP_001288302.1.33627 WP_001288302.1.3363 WP_001288302.1.33640 WP_001288302.1.33650 WP_001288302.1.33654 WP_001288302.1.33655 WP_001288302.1.33692 WP_001288302.1.33695 WP_001288302.1.33707 WP_001288302.1.33718 WP_001288302.1.33724 WP_001288302.1.33735 WP_001288302.1.33737 WP_001288302.1.33743 WP_001288302.1.33756 WP_001288302.1.33765 WP_001288302.1.33766 WP_001288302.1.33767 WP_001288302.1.33769 WP_001288302.1.33778 WP_001288302.1.33792 WP_001288302.1.33804 WP_001288302.1.33813 WP_001288302.1.33816 WP_001288302.1.33850 WP_001288302.1.33899 WP_001288302.1.33940 WP_001288302.1.33966 WP_001288302.1.33968 WP_001288302.1.33971 WP_001288302.1.33983 WP_001288302.1.33989 WP_001288302.1.33994 WP_001288302.1.34026 WP_001288302.1.34030 WP_001288302.1.34051 WP_001288302.1.34060 WP_001288302.1.34062 WP_001288302.1.34069 WP_001288302.1.34078 WP_001288302.1.34080 WP_001288302.1.34089 WP_001288302.1.34100 WP_001288302.1.34105 WP_001288302.1.34112 WP_001288302.1.34128 WP_001288302.1.34132 WP_001288302.1.34168 WP_001288302.1.34172 WP_001288302.1.3418 WP_001288302.1.34182 WP_001288302.1.34194 WP_001288302.1.34209 WP_001288302.1.34223 WP_001288302.1.34244 WP_001288302.1.34249 WP_001288302.1.34250 WP_001288302.1.34251 WP_001288302.1.34254 WP_001288302.1.34280 WP_001288302.1.34285 WP_001288302.1.34307 WP_001288302.1.34334 WP_001288302.1.34361 WP_001288302.1.34381 WP_001288302.1.34403 WP_001288302.1.34410 WP_001288302.1.3442 WP_001288302.1.34427 WP_001288302.1.34436 WP_001288302.1.34438 WP_001288302.1.34471 WP_001288302.1.34473 WP_001288302.1.3448 WP_001288302.1.34482 WP_001288302.1.34492 WP_001288302.1.34502 WP_001288302.1.34510 WP_001288302.1.34512 WP_001288302.1.34526 WP_001288302.1.34531 WP_001288302.1.34569 WP_001288302.1.34578 WP_001288302.1.3461 WP_001288302.1.34620 WP_001288302.1.34677 WP_001288302.1.34716 WP_001288302.1.34723 WP_001288302.1.34733 WP_001288302.1.34737 WP_001288302.1.3474 WP_001288302.1.34741 WP_001288302.1.34767 WP_001288302.1.34774 WP_001288302.1.34818 WP_001288302.1.34847 WP_001288302.1.34865 WP_001288302.1.34877 WP_001288302.1.34890 WP_001288302.1.34912 WP_001288302.1.34918 WP_001288302.1.34926 WP_001288302.1.34943 WP_001288302.1.34967 WP_001288302.1.34970 WP_001288302.1.34998 WP_001288302.1.35014 WP_001288302.1.35029 WP_001288302.1.35031 WP_001288302.1.35032 WP_001288302.1.35054 WP_001288302.1.35059 WP_001288302.1.35062 WP_001288302.1.35089 WP_001288302.1.35097 WP_001288302.1.35110 WP_001288302.1.35121 WP_001288302.1.35182 WP_001288302.1.35183 WP_001288302.1.35194 WP_001288302.1.35233 WP_001288302.1.35243 WP_001288302.1.3526 WP_001288302.1.35264 WP_001288302.1.35276 WP_001288302.1.35285 WP_001288302.1.35289 WP_001288302.1.35297 WP_001288302.1.35307 WP_001288302.1.35314 WP_001288302.1.35334 WP_001288302.1.35340 WP_001288302.1.35342 WP_001288302.1.35345 WP_001288302.1.35391 WP_001288302.1.354 WP_001288302.1.35413 WP_001288302.1.35415 WP_001288302.1.3542 WP_001288302.1.35423 WP_001288302.1.35433 WP_001288302.1.35435 WP_001288302.1.3547 WP_001288302.1.3549 WP_001288302.1.35498 WP_001288302.1.35506 WP_001288302.1.35508 WP_001288302.1.35517 WP_001288302.1.35519 WP_001288302.1.35525 WP_001288302.1.35549 WP_001288302.1.35580 WP_001288302.1.35615 WP_001288302.1.35623 WP_001288302.1.35642 WP_001288302.1.35659 WP_001288302.1.35661 WP_001288302.1.35673 WP_001288302.1.35686 WP_001288302.1.3569 WP_001288302.1.35696 WP_001288302.1.35730 WP_001288302.1.3574 WP_001288302.1.35742 WP_001288302.1.35746 WP_001288302.1.35784 WP_001288302.1.3579 WP_001288302.1.35801 WP_001288302.1.35826 WP_001288302.1.35837 WP_001288302.1.35888 WP_001288302.1.35890 WP_001288302.1.35900 WP_001288302.1.35903 WP_001288302.1.35928 WP_001288302.1.35933 WP_001288302.1.35950 WP_001288302.1.35958 WP_001288302.1.36004 WP_001288302.1.36041 WP_001288302.1.36082 WP_001288302.1.36093 WP_001288302.1.36102 WP_001288302.1.3611 WP_001288302.1.36119 WP_001288302.1.36141 WP_001288302.1.3617 WP_001288302.1.36176 WP_001288302.1.36179 WP_001288302.1.36187 WP_001288302.1.36188 WP_001288302.1.36208 WP_001288302.1.36211 WP_001288302.1.36223 WP_001288302.1.36231 WP_001288302.1.36249 WP_001288302.1.36250 WP_001288302.1.36264 WP_001288302.1.36278 WP_001288302.1.36282 WP_001288302.1.36302 WP_001288302.1.36307 WP_001288302.1.36344 WP_001288302.1.36389 WP_001288302.1.36430 WP_001288302.1.36434 WP_001288302.1.36439 WP_001288302.1.36532 WP_001288302.1.36535 WP_001288302.1.3655 WP_001288302.1.36570 WP_001288302.1.36580 WP_001288302.1.36600 WP_001288302.1.36615 WP_001288302.1.36640 WP_001288302.1.36646 WP_001288302.1.3666 WP_001288302.1.36669 WP_001288302.1.36689 WP_001288302.1.36697 WP_001288302.1.36698 WP_001288302.1.36704 WP_001288302.1.36729 WP_001288302.1.36745 WP_001288302.1.3675 WP_001288302.1.36754 WP_001288302.1.36773 WP_001288302.1.36783 WP_001288302.1.36793 WP_001288302.1.36796 WP_001288302.1.36797 WP_001288302.1.36814 WP_001288302.1.36820 WP_001288302.1.36822 WP_001288302.1.36823 WP_001288302.1.36847 WP_001288302.1.3685 WP_001288302.1.36858 WP_001288302.1.3687 WP_001288302.1.3690 WP_001288302.1.36903 WP_001288302.1.36911 WP_001288302.1.36916 WP_001288302.1.36932 WP_001288302.1.36952 WP_001288302.1.36955 WP_001288302.1.36962 WP_001288302.1.36979 WP_001288302.1.36980 WP_001288302.1.36983 WP_001288302.1.36997 WP_001288302.1.37002 WP_001288302.1.37016 WP_001288302.1.3703 WP_001288302.1.37044 WP_001288302.1.37045 WP_001288302.1.37053 WP_001288302.1.37055 WP_001288302.1.37075 WP_001288302.1.37080 WP_001288302.1.3709 WP_001288302.1.37091 WP_001288302.1.37120 WP_001288302.1.37121 WP_001288302.1.37130 WP_001288302.1.37134 WP_001288302.1.37135 WP_001288302.1.37145 WP_001288302.1.37159 WP_001288302.1.3718 WP_001288302.1.3719 WP_001288302.1.3722 WP_001288302.1.37220 WP_001288302.1.37240 WP_001288302.1.37335 WP_001288302.1.37336 WP_001288302.1.37341 WP_001288302.1.37343 WP_001288302.1.37378 WP_001288302.1.37398 WP_001288302.1.37408 WP_001288302.1.37411 WP_001288302.1.37424 WP_001288302.1.37435 WP_001288302.1.37453 WP_001288302.1.37467 WP_001288302.1.37503 WP_001288302.1.37525 WP_001288302.1.37536 WP_001288302.1.37546 WP_001288302.1.37578 WP_001288302.1.37583 WP_001288302.1.37602 WP_001288302.1.37605 WP_001288302.1.37606 WP_001288302.1.37621 WP_001288302.1.37624 WP_001288302.1.37644 WP_001288302.1.37669 WP_001288302.1.37679 WP_001288302.1.3774 WP_001288302.1.37749 WP_001288302.1.37764 WP_001288302.1.37771 WP_001288302.1.37781 WP_001288302.1.37788 WP_001288302.1.37815 WP_001288302.1.37828 WP_001288302.1.3784 WP_001288302.1.37851 WP_001288302.1.37855 WP_001288302.1.37866 WP_001288302.1.37875 WP_001288302.1.37878 WP_001288302.1.37891 WP_001288302.1.37906 WP_001288302.1.37907 WP_001288302.1.37929 WP_001288302.1.37953 WP_001288302.1.37987 WP_001288302.1.38020 WP_001288302.1.38030 WP_001288302.1.38034 WP_001288302.1.38038 WP_001288302.1.38057 WP_001288302.1.38070 WP_001288302.1.38082 WP_001288302.1.3809 WP_001288302.1.38100 WP_001288302.1.38111 WP_001288302.1.38128 WP_001288302.1.3813 WP_001288302.1.38136 WP_001288302.1.38148 WP_001288302.1.38160 WP_001288302.1.3817 WP_001288302.1.38177 WP_001288302.1.3820 WP_001288302.1.38212 WP_001288302.1.38222 WP_001288302.1.38229 WP_001288302.1.38230 WP_001288302.1.38232 WP_001288302.1.38276 WP_001288302.1.38282 WP_001288302.1.38304 WP_001288302.1.38309 WP_001288302.1.38311 WP_001288302.1.38316 WP_001288302.1.38339 WP_001288302.1.38383 WP_001288302.1.38390 WP_001288302.1.3842 WP_001288302.1.38422 WP_001288302.1.38435 WP_001288302.1.38437 WP_001288302.1.38453 WP_001288302.1.38491 WP_001288302.1.38493 WP_001288302.1.3850 WP_001288302.1.38516 WP_001288302.1.3852 WP_001288302.1.38522 WP_001288302.1.38546 WP_001288302.1.38555 WP_001288302.1.38557 WP_001288302.1.38607 WP_001288302.1.38612 WP_001288302.1.38637 WP_001288302.1.38651 WP_001288302.1.38658 WP_001288302.1.38669 WP_001288302.1.3867 WP_001288302.1.38674 WP_001288302.1.38688 WP_001288302.1.38721 WP_001288302.1.3875 WP_001288302.1.38760 WP_001288302.1.38786 WP_001288302.1.38788 WP_001288302.1.38823 WP_001288302.1.38836 WP_001288302.1.38841 WP_001288302.1.38858 WP_001288302.1.38862 WP_001288302.1.38875 WP_001288302.1.38885 WP_001288302.1.38890 WP_001288302.1.38926 WP_001288302.1.38927 WP_001288302.1.38931 WP_001288302.1.38940 WP_001288302.1.38941 WP_001288302.1.38943 WP_001288302.1.38960 WP_001288302.1.38972 WP_001288302.1.38973 WP_001288302.1.38979 WP_001288302.1.38985 WP_001288302.1.38989 WP_001288302.1.390 WP_001288302.1.39012 WP_001288302.1.39014 WP_001288302.1.39017 WP_001288302.1.39020 WP_001288302.1.39026 WP_001288302.1.39043 WP_001288302.1.39053 WP_001288302.1.3906 WP_001288302.1.3908 WP_001288302.1.39080 WP_001288302.1.39089 WP_001288302.1.391 WP_001288302.1.39108 WP_001288302.1.39126 WP_001288302.1.39166 WP_001288302.1.39173 WP_001288302.1.39203 WP_001288302.1.39206 WP_001288302.1.39217 WP_001288302.1.39241 WP_001288302.1.3926 WP_001288302.1.39272 WP_001288302.1.39285 WP_001288302.1.39290 WP_001288302.1.39324 WP_001288302.1.39330 WP_001288302.1.39332 WP_001288302.1.39333 WP_001288302.1.39347 WP_001288302.1.39361 WP_001288302.1.39378 WP_001288302.1.39384 WP_001288302.1.39397 WP_001288302.1.39406 WP_001288302.1.39432 WP_001288302.1.39451 WP_001288302.1.39486 WP_001288302.1.39494 WP_001288302.1.39499 WP_001288302.1.39506 WP_001288302.1.39519 WP_001288302.1.39527 WP_001288302.1.39542 WP_001288302.1.39550 WP_001288302.1.39613 WP_001288302.1.39642 WP_001288302.1.39645 WP_001288302.1.39670 WP_001288302.1.39671 WP_001288302.1.39682 WP_001288302.1.39687 WP_001288302.1.39689 WP_001288302.1.39693 WP_001288302.1.39697 WP_001288302.1.39711 WP_001288302.1.39738 WP_001288302.1.39767 WP_001288302.1.39789 WP_001288302.1.39832 WP_001288302.1.39838 WP_001288302.1.39839 WP_001288302.1.39847 WP_001288302.1.39856 WP_001288302.1.39857 WP_001288302.1.39869 WP_001288302.1.39883 WP_001288302.1.39918 WP_001288302.1.39943 WP_001288302.1.39995 WP_001288302.1.40014 WP_001288302.1.40043 WP_001288302.1.40076 WP_001288302.1.40082 WP_001288302.1.40099 WP_001288302.1.4010 WP_001288302.1.40119 WP_001288302.1.40120 WP_001288302.1.40137 WP_001288302.1.40149 WP_001288302.1.4015 WP_001288302.1.40161 WP_001288302.1.40164 WP_001288302.1.40173 WP_001288302.1.4019 WP_001288302.1.40247 WP_001288302.1.40299 WP_001288302.1.40318 WP_001288302.1.40320 WP_001288302.1.40329 WP_001288302.1.40330 WP_001288302.1.40340 WP_001288302.1.40342 WP_001288302.1.40368 WP_001288302.1.40369 WP_001288302.1.40383 WP_001288302.1.40401 WP_001288302.1.40406 WP_001288302.1.40409 WP_001288302.1.40428 WP_001288302.1.40443 WP_001288302.1.4045 WP_001288302.1.40454 WP_001288302.1.40458 WP_001288302.1.40463 WP_001288302.1.40472 WP_001288302.1.40474 WP_001288302.1.40481 WP_001288302.1.40483 WP_001288302.1.40500 WP_001288302.1.40505 WP_001288302.1.40531 WP_001288302.1.40532 WP_001288302.1.40554 WP_001288302.1.4056 WP_001288302.1.4057 WP_001288302.1.40579 WP_001288302.1.40588 WP_001288302.1.40613 WP_001288302.1.40620 WP_001288302.1.40644 WP_001288302.1.40655 WP_001288302.1.40658 WP_001288302.1.40659 WP_001288302.1.40670 WP_001288302.1.40700 WP_001288302.1.40719 WP_001288302.1.40729 WP_001288302.1.40748 WP_001288302.1.40760 WP_001288302.1.4078 WP_001288302.1.40780 WP_001288302.1.40794 WP_001288302.1.40797 WP_001288302.1.40800 WP_001288302.1.40814 WP_001288302.1.40816 WP_001288302.1.40939 WP_001288302.1.40997 WP_001288302.1.41002 WP_001288302.1.41011 WP_001288302.1.4102 WP_001288302.1.41033 WP_001288302.1.41038 WP_001288302.1.4105 WP_001288302.1.41058 WP_001288302.1.41064 WP_001288302.1.41066 WP_001288302.1.41084 WP_001288302.1.41094 WP_001288302.1.41098 WP_001288302.1.41104 WP_001288302.1.41119 WP_001288302.1.41122 WP_001288302.1.41129 WP_001288302.1.41133 WP_001288302.1.4115 WP_001288302.1.41178 WP_001288302.1.412 WP_001288302.1.41208 WP_001288302.1.41241 WP_001288302.1.41255 WP_001288302.1.41289 WP_001288302.1.4129 WP_001288302.1.41341 WP_001288302.1.41350 WP_001288302.1.41374 WP_001288302.1.41386 WP_001288302.1.41389 WP_001288302.1.41411 WP_001288302.1.41426 WP_001288302.1.41432 WP_001288302.1.41433 WP_001288302.1.4144 WP_001288302.1.41448 WP_001288302.1.41456 WP_001288302.1.41458 WP_001288302.1.41473 WP_001288302.1.41499 WP_001288302.1.41511 WP_001288302.1.41532 WP_001288302.1.41533 WP_001288302.1.41537 WP_001288302.1.41555 WP_001288302.1.41558 WP_001288302.1.41567 WP_001288302.1.41581 WP_001288302.1.41582 WP_001288302.1.41587 WP_001288302.1.41597 WP_001288302.1.41598 WP_001288302.1.41612 WP_001288302.1.41620 WP_001288302.1.41623 WP_001288302.1.41647 WP_001288302.1.41674 WP_001288302.1.41681 WP_001288302.1.4169 WP_001288302.1.41698 WP_001288302.1.41726 WP_001288302.1.41743 WP_001288302.1.41755 WP_001288302.1.41770 WP_001288302.1.41796 WP_001288302.1.41817 WP_001288302.1.4182 WP_001288302.1.41821 WP_001288302.1.41839 WP_001288302.1.4188 WP_001288302.1.41891 WP_001288302.1.41898 WP_001288302.1.41935 WP_001288302.1.41943 WP_001288302.1.41954 WP_001288302.1.41972 WP_001288302.1.41983 WP_001288302.1.41989 WP_001288302.1.420 WP_001288302.1.42001 WP_001288302.1.42003 WP_001288302.1.42015 WP_001288302.1.42017 WP_001288302.1.4202 WP_001288302.1.42028 WP_001288302.1.42056 WP_001288302.1.42064 WP_001288302.1.42072 WP_001288302.1.42085 WP_001288302.1.42087 WP_001288302.1.42125 WP_001288302.1.42137 WP_001288302.1.42169 WP_001288302.1.42178 WP_001288302.1.42198 WP_001288302.1.42230 WP_001288302.1.42241 WP_001288302.1.4225 WP_001288302.1.42269 WP_001288302.1.42286 WP_001288302.1.42298 WP_001288302.1.42305 WP_001288302.1.42325 WP_001288302.1.42336 WP_001288302.1.42344 WP_001288302.1.42355 WP_001288302.1.42403 WP_001288302.1.42436 WP_001288302.1.42459 WP_001288302.1.42481 WP_001288302.1.42510 WP_001288302.1.42551 WP_001288302.1.42575 WP_001288302.1.42593 WP_001288302.1.426 WP_001288302.1.42607 WP_001288302.1.42640 WP_001288302.1.42652 WP_001288302.1.42667 WP_001288302.1.42668 WP_001288302.1.42674 WP_001288302.1.42679 WP_001288302.1.42681 WP_001288302.1.42733 WP_001288302.1.42737 WP_001288302.1.42738 WP_001288302.1.42740 WP_001288302.1.42759 WP_001288302.1.42764 WP_001288302.1.42786 WP_001288302.1.42788 WP_001288302.1.42798 WP_001288302.1.42816 WP_001288302.1.42819 WP_001288302.1.42837 WP_001288302.1.42848 WP_001288302.1.42883 WP_001288302.1.42897 WP_001288302.1.42907 WP_001288302.1.42924 WP_001288302.1.42925 WP_001288302.1.4293 WP_001288302.1.42959 WP_001288302.1.42984 WP_001288302.1.42985 WP_001288302.1.4299 WP_001288302.1.42990 WP_001288302.1.4300 WP_001288302.1.43014 WP_001288302.1.43020 WP_001288302.1.43023 WP_001288302.1.43047 WP_001288302.1.43061 WP_001288302.1.43072 WP_001288302.1.43095 WP_001288302.1.43110 WP_001288302.1.43114 WP_001288302.1.43122 WP_001288302.1.43125 WP_001288302.1.43131 WP_001288302.1.43134 WP_001288302.1.43139 WP_001288302.1.43143 WP_001288302.1.43147 WP_001288302.1.43159 WP_001288302.1.43165 WP_001288302.1.43168 WP_001288302.1.43179 WP_001288302.1.43200 WP_001288302.1.43202 WP_001288302.1.43204 WP_001288302.1.43206 WP_001288302.1.43220 WP_001288302.1.43225 WP_001288302.1.43232 WP_001288302.1.43248 WP_001288302.1.4325 WP_001288302.1.43252 WP_001288302.1.43263 WP_001288302.1.4327 WP_001288302.1.43274 WP_001288302.1.43279 WP_001288302.1.43323 WP_001288302.1.43331 WP_001288302.1.43341 WP_001288302.1.43349 WP_001288302.1.43360 WP_001288302.1.43369 WP_001288302.1.4337 WP_001288302.1.43375 WP_001288302.1.43383 WP_001288302.1.43405 WP_001288302.1.43406 WP_001288302.1.4341 WP_001288302.1.43410 WP_001288302.1.43414 WP_001288302.1.43446 WP_001288302.1.43460 WP_001288302.1.4347 WP_001288302.1.43506 WP_001288302.1.43512 WP_001288302.1.43530 WP_001288302.1.43550 WP_001288302.1.43560 WP_001288302.1.43573 WP_001288302.1.43594 WP_001288302.1.43617 WP_001288302.1.43618 WP_001288302.1.43627 WP_001288302.1.43659 WP_001288302.1.43665 WP_001288302.1.43670 WP_001288302.1.43683 WP_001288302.1.4369 WP_001288302.1.43693 WP_001288302.1.43702 WP_001288302.1.43703 WP_001288302.1.4372 WP_001288302.1.43731 WP_001288302.1.43752 WP_001288302.1.43784 WP_001288302.1.43788 WP_001288302.1.4379 WP_001288302.1.4380 WP_001288302.1.43800 WP_001288302.1.43819 WP_001288302.1.43827 WP_001288302.1.4385 WP_001288302.1.43851 WP_001288302.1.4386 WP_001288302.1.43904 WP_001288302.1.43915 WP_001288302.1.43964 WP_001288302.1.43984 WP_001288302.1.43988 WP_001288302.1.43995 WP_001288302.1.44021 WP_001288302.1.44074 WP_001288302.1.44095 WP_001288302.1.44119 WP_001288302.1.44150 WP_001288302.1.44153 WP_001288302.1.44177 WP_001288302.1.44178 WP_001288302.1.44181 WP_001288302.1.44186 WP_001288302.1.44195 WP_001288302.1.44255 WP_001288302.1.44265 WP_001288302.1.44302 WP_001288302.1.44331 WP_001288302.1.44344 WP_001288302.1.44382 WP_001288302.1.44388 WP_001288302.1.44396 WP_001288302.1.44405 WP_001288302.1.44420 WP_001288302.1.44432 WP_001288302.1.44480 WP_001288302.1.44504 WP_001288302.1.44515 WP_001288302.1.44517 WP_001288302.1.44520 WP_001288302.1.44536 WP_001288302.1.44544 WP_001288302.1.44547 WP_001288302.1.44579 WP_001288302.1.44586 WP_001288302.1.44588 WP_001288302.1.44605 WP_001288302.1.44623 WP_001288302.1.44631 WP_001288302.1.44646 WP_001288302.1.44655 WP_001288302.1.44667 WP_001288302.1.44672 WP_001288302.1.447 WP_001288302.1.44714 WP_001288302.1.44715 WP_001288302.1.44732 WP_001288302.1.44755 WP_001288302.1.44780 WP_001288302.1.44785 WP_001288302.1.44788 WP_001288302.1.44796 WP_001288302.1.44853 WP_001288302.1.44856 WP_001288302.1.44868 WP_001288302.1.44876 WP_001288302.1.44881 WP_001288302.1.44882 WP_001288302.1.44892 WP_001288302.1.44899 WP_001288302.1.44903 WP_001288302.1.44914 WP_001288302.1.44940 WP_001288302.1.44948 WP_001288302.1.44955 WP_001288302.1.44969 WP_001288302.1.4499 WP_001288302.1.44993 WP_001288302.1.45008 WP_001288302.1.45010 WP_001288302.1.45033 WP_001288302.1.45035 WP_001288302.1.45042 WP_001288302.1.45050 WP_001288302.1.45080 WP_001288302.1.45091 WP_001288302.1.45094 WP_001288302.1.45099 WP_001288302.1.45101 WP_001288302.1.45114 WP_001288302.1.4513 WP_001288302.1.45131 WP_001288302.1.45132 WP_001288302.1.45133 WP_001288302.1.45140 WP_001288302.1.45157 WP_001288302.1.45162 WP_001288302.1.45164 WP_001288302.1.45170 WP_001288302.1.452 WP_001288302.1.45218 WP_001288302.1.45221 WP_001288302.1.45223 WP_001288302.1.45242 WP_001288302.1.45267 WP_001288302.1.4527 WP_001288302.1.45272 WP_001288302.1.45281 WP_001288302.1.45290 WP_001288302.1.45297 WP_001288302.1.453 WP_001288302.1.45303 WP_001288302.1.45364 WP_001288302.1.45419 WP_001288302.1.45431 WP_001288302.1.45439 WP_001288302.1.45447 WP_001288302.1.4545 WP_001288302.1.45450 WP_001288302.1.45456 WP_001288302.1.4546 WP_001288302.1.45472 WP_001288302.1.45492 WP_001288302.1.4550 WP_001288302.1.45507 WP_001288302.1.45542 WP_001288302.1.45555 WP_001288302.1.45560 WP_001288302.1.45574 WP_001288302.1.45577 WP_001288302.1.45586 WP_001288302.1.45610 WP_001288302.1.45620 WP_001288302.1.45645 WP_001288302.1.45654 WP_001288302.1.45670 WP_001288302.1.45703 WP_001288302.1.45705 WP_001288302.1.45730 WP_001288302.1.45734 WP_001288302.1.45747 WP_001288302.1.45763 WP_001288302.1.45768 WP_001288302.1.4577 WP_001288302.1.45771 WP_001288302.1.45773 WP_001288302.1.45780 WP_001288302.1.4582 WP_001288302.1.45822 WP_001288302.1.45833 WP_001288302.1.4584 WP_001288302.1.45852 WP_001288302.1.45859 WP_001288302.1.45862 WP_001288302.1.45874 WP_001288302.1.45878 WP_001288302.1.45897 WP_001288302.1.45954 WP_001288302.1.4597 WP_001288302.1.45972 WP_001288302.1.45977 WP_001288302.1.45979 WP_001288302.1.4598 WP_001288302.1.46003 WP_001288302.1.46005 WP_001288302.1.46013 WP_001288302.1.46021 WP_001288302.1.46035 WP_001288302.1.46037 WP_001288302.1.46050 WP_001288302.1.46055 WP_001288302.1.46062 WP_001288302.1.46078 WP_001288302.1.46082 WP_001288302.1.46087 WP_001288302.1.46109 WP_001288302.1.46136 WP_001288302.1.46168 WP_001288302.1.46171 WP_001288302.1.46172 WP_001288302.1.46185 WP_001288302.1.46195 WP_001288302.1.46208 WP_001288302.1.46222 WP_001288302.1.46228 WP_001288302.1.46248 WP_001288302.1.46259 WP_001288302.1.46276 WP_001288302.1.46289 WP_001288302.1.46330 WP_001288302.1.46333 WP_001288302.1.46334 WP_001288302.1.46339 WP_001288302.1.46353 WP_001288302.1.46362 WP_001288302.1.46368 WP_001288302.1.46380 WP_001288302.1.46389 WP_001288302.1.46401 WP_001288302.1.46418 WP_001288302.1.46422 WP_001288302.1.46465 WP_001288302.1.46488 WP_001288302.1.46514 WP_001288302.1.46529 WP_001288302.1.46543 WP_001288302.1.46576 WP_001288302.1.46587 WP_001288302.1.46608 WP_001288302.1.46619 WP_001288302.1.4662 WP_001288302.1.46648 WP_001288302.1.46660 WP_001288302.1.46664 WP_001288302.1.46670 WP_001288302.1.46676 WP_001288302.1.46692 WP_001288302.1.46696 WP_001288302.1.46702 WP_001288302.1.46703 WP_001288302.1.46720 WP_001288302.1.46736 WP_001288302.1.46752 WP_001288302.1.46765 WP_001288302.1.46770 WP_001288302.1.4680 WP_001288302.1.46815 WP_001288302.1.46837 WP_001288302.1.46881 WP_001288302.1.46906 WP_001288302.1.46908 WP_001288302.1.46911 WP_001288302.1.46914 WP_001288302.1.46925 WP_001288302.1.46929 WP_001288302.1.46937 WP_001288302.1.4694 WP_001288302.1.46947 WP_001288302.1.4696 WP_001288302.1.46965 WP_001288302.1.46983 WP_001288302.1.46995 WP_001288302.1.47002 WP_001288302.1.47051 WP_001288302.1.47065 WP_001288302.1.47090 WP_001288302.1.47105 WP_001288302.1.47107 WP_001288302.1.47111 WP_001288302.1.47128 WP_001288302.1.47153 WP_001288302.1.47159 WP_001288302.1.47163 WP_001288302.1.47175 WP_001288302.1.47187 WP_001288302.1.47193 WP_001288302.1.47211 WP_001288302.1.47216 WP_001288302.1.47250 WP_001288302.1.47258 WP_001288302.1.47269 WP_001288302.1.47276 WP_001288302.1.47279 WP_001288302.1.4728 WP_001288302.1.47282 WP_001288302.1.47290 WP_001288302.1.47294 WP_001288302.1.47306 WP_001288302.1.47308 WP_001288302.1.47328 WP_001288302.1.47331 WP_001288302.1.47334 WP_001288302.1.47353 WP_001288302.1.47381 WP_001288302.1.47399 WP_001288302.1.47406 WP_001288302.1.47408 WP_001288302.1.47426 WP_001288302.1.47432 WP_001288302.1.47439 WP_001288302.1.47450 WP_001288302.1.47459 WP_001288302.1.47493 WP_001288302.1.47522 WP_001288302.1.47530 WP_001288302.1.47541 WP_001288302.1.47554 WP_001288302.1.47560 WP_001288302.1.47561 WP_001288302.1.47617 WP_001288302.1.47618 WP_001288302.1.47629 WP_001288302.1.47667 WP_001288302.1.47669 WP_001288302.1.4767 WP_001288302.1.47680 WP_001288302.1.477 WP_001288302.1.47702 WP_001288302.1.47719 WP_001288302.1.47733 WP_001288302.1.47747 WP_001288302.1.47763 WP_001288302.1.47782 WP_001288302.1.47792 WP_001288302.1.47835 WP_001288302.1.47836 WP_001288302.1.47851 WP_001288302.1.47859 WP_001288302.1.47864 WP_001288302.1.47872 WP_001288302.1.47873 WP_001288302.1.47888 WP_001288302.1.47904 WP_001288302.1.47908 WP_001288302.1.4792 WP_001288302.1.47989 WP_001288302.1.47996 WP_001288302.1.48011 WP_001288302.1.48013 WP_001288302.1.48017 WP_001288302.1.48030 WP_001288302.1.48046 WP_001288302.1.48047 WP_001288302.1.4805 WP_001288302.1.48057 WP_001288302.1.48064 WP_001288302.1.48067 WP_001288302.1.48116 WP_001288302.1.48142 WP_001288302.1.48149 WP_001288302.1.4815 WP_001288302.1.48154 WP_001288302.1.48156 WP_001288302.1.48169 WP_001288302.1.48186 WP_001288302.1.48187 WP_001288302.1.48199 WP_001288302.1.48205 WP_001288302.1.48212 WP_001288302.1.48223 WP_001288302.1.48227 WP_001288302.1.48236 WP_001288302.1.48250 WP_001288302.1.48272 WP_001288302.1.48282 WP_001288302.1.48284 WP_001288302.1.48293 WP_001288302.1.48307 WP_001288302.1.48310 WP_001288302.1.48322 WP_001288302.1.48335 WP_001288302.1.48338 WP_001288302.1.48376 WP_001288302.1.48391 WP_001288302.1.48394 WP_001288302.1.48398 WP_001288302.1.4840 WP_001288302.1.48425 WP_001288302.1.48427 WP_001288302.1.48437 WP_001288302.1.48438 WP_001288302.1.48463 WP_001288302.1.48479 WP_001288302.1.4852 WP_001288302.1.48556 WP_001288302.1.48563 WP_001288302.1.48577 WP_001288302.1.48580 WP_001288302.1.48593 WP_001288302.1.48601 WP_001288302.1.48634 WP_001288302.1.48655 WP_001288302.1.48656 WP_001288302.1.48670 WP_001288302.1.4868 WP_001288302.1.48705 WP_001288302.1.48711 WP_001288302.1.48723 WP_001288302.1.48769 WP_001288302.1.48775 WP_001288302.1.48782 WP_001288302.1.48805 WP_001288302.1.48817 WP_001288302.1.48818 WP_001288302.1.48823 WP_001288302.1.48833 WP_001288302.1.48835 WP_001288302.1.4886 WP_001288302.1.48869 WP_001288302.1.48936 WP_001288302.1.48941 WP_001288302.1.48943 WP_001288302.1.48945 WP_001288302.1.48951 WP_001288302.1.48966 WP_001288302.1.48968 WP_001288302.1.48982 WP_001288302.1.48993 WP_001288302.1.48996 WP_001288302.1.4901 WP_001288302.1.49018 WP_001288302.1.49032 WP_001288302.1.4905 WP_001288302.1.49071 WP_001288302.1.49094 WP_001288302.1.49105 WP_001288302.1.49128 WP_001288302.1.49129 WP_001288302.1.49143 WP_001288302.1.49152 WP_001288302.1.49154 WP_001288302.1.49159 WP_001288302.1.4916 WP_001288302.1.49161 WP_001288302.1.4917 WP_001288302.1.49171 WP_001288302.1.49173 WP_001288302.1.4918 WP_001288302.1.49189 WP_001288302.1.49196 WP_001288302.1.49199 WP_001288302.1.4920 WP_001288302.1.49207 WP_001288302.1.49227 WP_001288302.1.49234 WP_001288302.1.4924 WP_001288302.1.49248 WP_001288302.1.49257 WP_001288302.1.49301 WP_001288302.1.49326 WP_001288302.1.49327 WP_001288302.1.49330 WP_001288302.1.49362 WP_001288302.1.49367 WP_001288302.1.49373 WP_001288302.1.49398 WP_001288302.1.49418 WP_001288302.1.49444 WP_001288302.1.4945 WP_001288302.1.49479 WP_001288302.1.4950 WP_001288302.1.49518 WP_001288302.1.49530 WP_001288302.1.49539 WP_001288302.1.49549 WP_001288302.1.49581 WP_001288302.1.49582 WP_001288302.1.496 WP_001288302.1.49603 WP_001288302.1.4962 WP_001288302.1.49643 WP_001288302.1.49653 WP_001288302.1.49669 WP_001288302.1.49672 WP_001288302.1.49690 WP_001288302.1.49704 WP_001288302.1.49715 WP_001288302.1.49728 WP_001288302.1.49730 WP_001288302.1.49732 WP_001288302.1.49742 WP_001288302.1.49745 WP_001288302.1.49757 WP_001288302.1.4980 WP_001288302.1.49800 WP_001288302.1.49819 WP_001288302.1.4982 WP_001288302.1.49825 WP_001288302.1.4984 WP_001288302.1.49860 WP_001288302.1.49863 WP_001288302.1.49871 WP_001288302.1.4989 WP_001288302.1.49894 WP_001288302.1.49907 WP_001288302.1.49912 WP_001288302.1.49913 WP_001288302.1.49918 WP_001288302.1.49921 WP_001288302.1.49934 WP_001288302.1.49935 WP_001288302.1.49936 WP_001288302.1.4994 WP_001288302.1.49970 WP_001288302.1.49982 WP_001288302.1.50013 WP_001288302.1.50015 WP_001288302.1.50028 WP_001288302.1.50038 WP_001288302.1.50039 WP_001288302.1.50061 WP_001288302.1.50071 WP_001288302.1.50117 WP_001288302.1.5013 WP_001288302.1.50138 WP_001288302.1.50145 WP_001288302.1.50178 WP_001288302.1.50192 WP_001288302.1.50217 WP_001288302.1.50219 WP_001288302.1.50229 WP_001288302.1.50261 WP_001288302.1.50291 WP_001288302.1.50313 WP_001288302.1.50314 WP_001288302.1.50356 WP_001288302.1.50360 WP_001288302.1.50367 WP_001288302.1.50369 WP_001288302.1.50377 WP_001288302.1.50388 WP_001288302.1.50425 WP_001288302.1.50431 WP_001288302.1.5045 WP_001288302.1.50464 WP_001288302.1.50477 WP_001288302.1.50516 WP_001288302.1.50525 WP_001288302.1.50536 WP_001288302.1.50555 WP_001288302.1.50556 WP_001288302.1.50558 WP_001288302.1.50568 WP_001288302.1.50578 WP_001288302.1.5059 WP_001288302.1.50594 WP_001288302.1.50595 WP_001288302.1.50647 WP_001288302.1.50660 WP_001288302.1.50669 WP_001288302.1.50699 WP_001288302.1.50711 WP_001288302.1.50745 WP_001288302.1.50759 WP_001288302.1.50768 WP_001288302.1.50799 WP_001288302.1.5080 WP_001288302.1.50817 WP_001288302.1.50820 WP_001288302.1.50827 WP_001288302.1.50829 WP_001288302.1.5087 WP_001288302.1.50884 WP_001288302.1.50937 WP_001288302.1.50962 WP_001288302.1.50974 WP_001288302.1.51008 WP_001288302.1.51015 WP_001288302.1.51031 WP_001288302.1.51062 WP_001288302.1.5108 WP_001288302.1.51085 WP_001288302.1.5109 WP_001288302.1.5110 WP_001288302.1.5111 WP_001288302.1.51130 WP_001288302.1.51138 WP_001288302.1.51152 WP_001288302.1.51209 WP_001288302.1.51226 WP_001288302.1.51236 WP_001288302.1.51245 WP_001288302.1.51250 WP_001288302.1.51271 WP_001288302.1.51277 WP_001288302.1.51282 WP_001288302.1.51295 WP_001288302.1.51306 WP_001288302.1.51310 WP_001288302.1.51326 WP_001288302.1.51346 WP_001288302.1.51365 WP_001288302.1.51376 WP_001288302.1.51393 WP_001288302.1.51403 WP_001288302.1.51454 WP_001288302.1.51456 WP_001288302.1.51492 WP_001288302.1.51496 WP_001288302.1.515 WP_001288302.1.51527 WP_001288302.1.5155 WP_001288302.1.51557 WP_001288302.1.51558 WP_001288302.1.51559 WP_001288302.1.51571 WP_001288302.1.51575 WP_001288302.1.51590 WP_001288302.1.51665 WP_001288302.1.51672 WP_001288302.1.51716 WP_001288302.1.51741 WP_001288302.1.51744 WP_001288302.1.51748 WP_001288302.1.51787 WP_001288302.1.51794 WP_001288302.1.51797 WP_001288302.1.51812 WP_001288302.1.51824 WP_001288302.1.51836 WP_001288302.1.51842 WP_001288302.1.51844 WP_001288302.1.5186 WP_001288302.1.51871 WP_001288302.1.51883 WP_001288302.1.5190 WP_001288302.1.51912 WP_001288302.1.51920 WP_001288302.1.51924 WP_001288302.1.51936 WP_001288302.1.51952 WP_001288302.1.51971 WP_001288302.1.51973 WP_001288302.1.51995 WP_001288302.1.52034 WP_001288302.1.52061 WP_001288302.1.52072 WP_001288302.1.52078 WP_001288302.1.5209 WP_001288302.1.521 WP_001288302.1.5213 WP_001288302.1.52151 WP_001288302.1.52162 WP_001288302.1.52182 WP_001288302.1.52185 WP_001288302.1.52193 WP_001288302.1.52195 WP_001288302.1.52198 WP_001288302.1.52210 WP_001288302.1.52224 WP_001288302.1.52251 WP_001288302.1.52252 WP_001288302.1.52259 WP_001288302.1.5228 WP_001288302.1.52289 WP_001288302.1.52296 WP_001288302.1.523 WP_001288302.1.52308 WP_001288302.1.5231 WP_001288302.1.52322 WP_001288302.1.52327 WP_001288302.1.52331 WP_001288302.1.52340 WP_001288302.1.52343 WP_001288302.1.52377 WP_001288302.1.52396 WP_001288302.1.52423 WP_001288302.1.52427 WP_001288302.1.52436 WP_001288302.1.52440 WP_001288302.1.52442 WP_001288302.1.52452 WP_001288302.1.52463 WP_001288302.1.52464 WP_001288302.1.5251 WP_001288302.1.52511 WP_001288302.1.52518 WP_001288302.1.52536 WP_001288302.1.52548 WP_001288302.1.52595 WP_001288302.1.52605 WP_001288302.1.52623 WP_001288302.1.52624 WP_001288302.1.52633 WP_001288302.1.52645 WP_001288302.1.52670 WP_001288302.1.52687 WP_001288302.1.52699 WP_001288302.1.52715 WP_001288302.1.52722 WP_001288302.1.52751 WP_001288302.1.52754 WP_001288302.1.52772 WP_001288302.1.52820 WP_001288302.1.52830 WP_001288302.1.52836 WP_001288302.1.52838 WP_001288302.1.52848 WP_001288302.1.52865 WP_001288302.1.52877 WP_001288302.1.52878 WP_001288302.1.52886 WP_001288302.1.52889 WP_001288302.1.52893 WP_001288302.1.52900 WP_001288302.1.52904 WP_001288302.1.52941 WP_001288302.1.52947 WP_001288302.1.52965 WP_001288302.1.52983 WP_001288302.1.52984 WP_001288302.1.53002 WP_001288302.1.53007 WP_001288302.1.5304 WP_001288302.1.53050 WP_001288302.1.53057 WP_001288302.1.53071 WP_001288302.1.53077 WP_001288302.1.53140 WP_001288302.1.53153 WP_001288302.1.53178 WP_001288302.1.53189 WP_001288302.1.5319 WP_001288302.1.53209 WP_001288302.1.5321 WP_001288302.1.5323 WP_001288302.1.53260 WP_001288302.1.53285 WP_001288302.1.53312 WP_001288302.1.53317 WP_001288302.1.53319 WP_001288302.1.53323 WP_001288302.1.53352 WP_001288302.1.53363 WP_001288302.1.53372 WP_001288302.1.53373 WP_001288302.1.53379 WP_001288302.1.53387 WP_001288302.1.53394 WP_001288302.1.53403 WP_001288302.1.53408 WP_001288302.1.53418 WP_001288302.1.53432 WP_001288302.1.53433 WP_001288302.1.53452 WP_001288302.1.53462 WP_001288302.1.53467 WP_001288302.1.5347 WP_001288302.1.53488 WP_001288302.1.53503 WP_001288302.1.53521 WP_001288302.1.53532 WP_001288302.1.53577 WP_001288302.1.5359 WP_001288302.1.53641 WP_001288302.1.53648 WP_001288302.1.53661 WP_001288302.1.53671 WP_001288302.1.53682 WP_001288302.1.53691 WP_001288302.1.53712 WP_001288302.1.53714 WP_001288302.1.53759 WP_001288302.1.53763 WP_001288302.1.53766 WP_001288302.1.53774 WP_001288302.1.53786 WP_001288302.1.53799 WP_001288302.1.53827 WP_001288302.1.53835 WP_001288302.1.53886 WP_001288302.1.53889 WP_001288302.1.53911 WP_001288302.1.53915 WP_001288302.1.53926 WP_001288302.1.53934 WP_001288302.1.53969 WP_001288302.1.53999 WP_001288302.1.5401 WP_001288302.1.54022 WP_001288302.1.54029 WP_001288302.1.54048 WP_001288302.1.54049 WP_001288302.1.54074 WP_001288302.1.54086 WP_001288302.1.54094 WP_001288302.1.54105 WP_001288302.1.54109 WP_001288302.1.54135 WP_001288302.1.54147 WP_001288302.1.54161 WP_001288302.1.54229 WP_001288302.1.54237 WP_001288302.1.54246 WP_001288302.1.54253 WP_001288302.1.54269 WP_001288302.1.54290 WP_001288302.1.54297 WP_001288302.1.54299 WP_001288302.1.54373 WP_001288302.1.54395 WP_001288302.1.544 WP_001288302.1.54404 WP_001288302.1.54413 WP_001288302.1.54438 WP_001288302.1.54446 WP_001288302.1.54471 WP_001288302.1.54477 WP_001288302.1.54479 WP_001288302.1.54485 WP_001288302.1.54491 WP_001288302.1.54503 WP_001288302.1.54510 WP_001288302.1.54543 WP_001288302.1.54551 WP_001288302.1.54554 WP_001288302.1.54574 WP_001288302.1.54637 WP_001288302.1.54675 WP_001288302.1.54689 WP_001288302.1.5469 WP_001288302.1.54728 WP_001288302.1.54744 WP_001288302.1.54745 WP_001288302.1.54753 WP_001288302.1.54847 WP_001288302.1.54851 WP_001288302.1.54878 WP_001288302.1.54895 WP_001288302.1.54914 WP_001288302.1.54929 WP_001288302.1.54931 WP_001288302.1.54955 WP_001288302.1.54967 WP_001288302.1.54990 WP_001288302.1.5500 WP_001288302.1.55004 WP_001288302.1.55014 WP_001288302.1.55058 WP_001288302.1.55082 WP_001288302.1.55084 WP_001288302.1.55090 WP_001288302.1.55095 WP_001288302.1.55100 WP_001288302.1.55139 WP_001288302.1.5518 WP_001288302.1.5519 WP_001288302.1.552 WP_001288302.1.55214 WP_001288302.1.55239 WP_001288302.1.55271 WP_001288302.1.55272 WP_001288302.1.55274 WP_001288302.1.55309 WP_001288302.1.55327 WP_001288302.1.55336 WP_001288302.1.55352 WP_001288302.1.55353 WP_001288302.1.5536 WP_001288302.1.55367 WP_001288302.1.55369 WP_001288302.1.55403 WP_001288302.1.55405 WP_001288302.1.55419 WP_001288302.1.55421 WP_001288302.1.55495 WP_001288302.1.5550 WP_001288302.1.55508 WP_001288302.1.55527 WP_001288302.1.55535 WP_001288302.1.5554 WP_001288302.1.55544 WP_001288302.1.55558 WP_001288302.1.5556 WP_001288302.1.55583 WP_001288302.1.5559 WP_001288302.1.55603 WP_001288302.1.5562 WP_001288302.1.55620 WP_001288302.1.55628 WP_001288302.1.55637 WP_001288302.1.5565 WP_001288302.1.55653 WP_001288302.1.55657 WP_001288302.1.557 WP_001288302.1.55717 WP_001288302.1.55719 WP_001288302.1.55724 WP_001288302.1.55728 WP_001288302.1.5575 WP_001288302.1.55784 WP_001288302.1.55786 WP_001288302.1.5580 WP_001288302.1.55831 WP_001288302.1.55835 WP_001288302.1.55839 WP_001288302.1.55845 WP_001288302.1.55848 WP_001288302.1.55859 WP_001288302.1.55867 WP_001288302.1.55874 WP_001288302.1.55886 WP_001288302.1.5589 WP_001288302.1.55904 WP_001288302.1.55916 WP_001288302.1.55933 WP_001288302.1.55949 WP_001288302.1.55953 WP_001288302.1.55955 WP_001288302.1.55960 WP_001288302.1.55985 WP_001288302.1.55991 WP_001288302.1.56000 WP_001288302.1.56003 WP_001288302.1.56025 WP_001288302.1.5604 WP_001288302.1.56048 WP_001288302.1.5606 WP_001288302.1.56064 WP_001288302.1.56078 WP_001288302.1.56098 WP_001288302.1.56099 WP_001288302.1.56106 WP_001288302.1.56135 WP_001288302.1.56159 WP_001288302.1.56200 WP_001288302.1.56210 WP_001288302.1.56213 WP_001288302.1.56220 WP_001288302.1.56225 WP_001288302.1.5623 WP_001288302.1.56237 WP_001288302.1.56239 WP_001288302.1.56241 WP_001288302.1.56260 WP_001288302.1.56265 WP_001288302.1.56272 WP_001288302.1.56275 WP_001288302.1.56281 WP_001288302.1.56306 WP_001288302.1.56332 WP_001288302.1.56333 WP_001288302.1.5635 WP_001288302.1.56364 WP_001288302.1.5637 WP_001288302.1.56377 WP_001288302.1.56387 WP_001288302.1.56400 WP_001288302.1.5644 WP_001288302.1.56444 WP_001288302.1.56464 WP_001288302.1.56482 WP_001288302.1.56522 WP_001288302.1.56525 WP_001288302.1.56527 WP_001288302.1.56530 WP_001288302.1.56542 WP_001288302.1.5658 WP_001288302.1.56584 WP_001288302.1.56598 WP_001288302.1.566 WP_001288302.1.56608 WP_001288302.1.56619 WP_001288302.1.56628 WP_001288302.1.56641 WP_001288302.1.56658 WP_001288302.1.5666 WP_001288302.1.56679 WP_001288302.1.56696 WP_001288302.1.56702 WP_001288302.1.56708 WP_001288302.1.56722 WP_001288302.1.5675 WP_001288302.1.56767 WP_001288302.1.5677 WP_001288302.1.56772 WP_001288302.1.56778 WP_001288302.1.56779 WP_001288302.1.56794 WP_001288302.1.56803 WP_001288302.1.56815 WP_001288302.1.56822 WP_001288302.1.56856 WP_001288302.1.5686 WP_001288302.1.56865 WP_001288302.1.56878 WP_001288302.1.569 WP_001288302.1.56903 WP_001288302.1.56931 WP_001288302.1.56966 WP_001288302.1.56967 WP_001288302.1.56975 WP_001288302.1.56986 WP_001288302.1.57015 WP_001288302.1.57024 WP_001288302.1.57047 WP_001288302.1.5705 WP_001288302.1.57073 WP_001288302.1.57075 WP_001288302.1.57080 WP_001288302.1.57081 WP_001288302.1.57097 WP_001288302.1.57102 WP_001288302.1.57109 WP_001288302.1.57115 WP_001288302.1.57141 WP_001288302.1.57158 WP_001288302.1.57170 WP_001288302.1.5718 WP_001288302.1.57190 WP_001288302.1.57196 WP_001288302.1.57214 WP_001288302.1.57265 WP_001288302.1.57271 WP_001288302.1.57291 WP_001288302.1.57309 WP_001288302.1.57330 WP_001288302.1.57338 WP_001288302.1.5735 WP_001288302.1.57385 WP_001288302.1.57389 WP_001288302.1.57427 WP_001288302.1.5743 WP_001288302.1.57445 WP_001288302.1.57448 WP_001288302.1.57459 WP_001288302.1.57481 WP_001288302.1.5749 WP_001288302.1.57577 WP_001288302.1.57593 WP_001288302.1.57594 WP_001288302.1.57612 WP_001288302.1.57614 WP_001288302.1.57635 WP_001288302.1.57650 WP_001288302.1.57665 WP_001288302.1.57670 WP_001288302.1.57682 WP_001288302.1.57692 WP_001288302.1.57693 WP_001288302.1.57701 WP_001288302.1.57718 WP_001288302.1.57723 WP_001288302.1.57727 WP_001288302.1.57730 WP_001288302.1.57734 WP_001288302.1.57745 WP_001288302.1.57754 WP_001288302.1.57783 WP_001288302.1.57808 WP_001288302.1.57819 WP_001288302.1.57837 WP_001288302.1.57840 WP_001288302.1.57844 WP_001288302.1.57861 WP_001288302.1.57875 WP_001288302.1.57878 WP_001288302.1.57883 WP_001288302.1.5791 WP_001288302.1.57928 WP_001288302.1.57943 WP_001288302.1.57944 WP_001288302.1.57952 WP_001288302.1.57962 WP_001288302.1.57974 WP_001288302.1.5799 WP_001288302.1.58006 WP_001288302.1.58016 WP_001288302.1.58035 WP_001288302.1.58042 WP_001288302.1.58049 WP_001288302.1.58051 WP_001288302.1.58074 WP_001288302.1.58106 WP_001288302.1.58116 WP_001288302.1.58122 WP_001288302.1.58127 WP_001288302.1.58139 WP_001288302.1.58148 WP_001288302.1.58158 WP_001288302.1.5816 WP_001288302.1.5817 WP_001288302.1.58185 WP_001288302.1.58198 WP_001288302.1.58212 WP_001288302.1.58241 WP_001288302.1.58242 WP_001288302.1.58246 WP_001288302.1.5827 WP_001288302.1.58277 WP_001288302.1.58317 WP_001288302.1.5832 WP_001288302.1.58321 WP_001288302.1.58325 WP_001288302.1.58350 WP_001288302.1.58352 WP_001288302.1.58353 WP_001288302.1.58364 WP_001288302.1.58366 WP_001288302.1.58373 WP_001288302.1.58392 WP_001288302.1.58395 WP_001288302.1.58419 WP_001288302.1.58421 WP_001288302.1.58430 WP_001288302.1.58435 WP_001288302.1.58481 WP_001288302.1.5849 WP_001288302.1.58495 WP_001288302.1.58497 WP_001288302.1.58504 WP_001288302.1.58508 WP_001288302.1.58521 WP_001288302.1.58530 WP_001288302.1.58538 WP_001288302.1.58549 WP_001288302.1.5857 WP_001288302.1.58571 WP_001288302.1.58584 WP_001288302.1.58588 WP_001288302.1.58592 WP_001288302.1.58598 WP_001288302.1.586 WP_001288302.1.58603 WP_001288302.1.58626 WP_001288302.1.58686 WP_001288302.1.58704 WP_001288302.1.58714 WP_001288302.1.58718 WP_001288302.1.58735 WP_001288302.1.58760 WP_001288302.1.58763 WP_001288302.1.58772 WP_001288302.1.58775 WP_001288302.1.5880 WP_001288302.1.58833 WP_001288302.1.58839 WP_001288302.1.58860 WP_001288302.1.58934 WP_001288302.1.58936 WP_001288302.1.58960 WP_001288302.1.58981 WP_001288302.1.58998 WP_001288302.1.5901 WP_001288302.1.59011 WP_001288302.1.59014 WP_001288302.1.59039 WP_001288302.1.5904 WP_001288302.1.59046 WP_001288302.1.59062 WP_001288302.1.59077 WP_001288302.1.59098 WP_001288302.1.59124 WP_001288302.1.59133 WP_001288302.1.59146 WP_001288302.1.59157 WP_001288302.1.59175 WP_001288302.1.59178 WP_001288302.1.59187 WP_001288302.1.5920 WP_001288302.1.5925 WP_001288302.1.59269 WP_001288302.1.59284 WP_001288302.1.5930 WP_001288302.1.59311 WP_001288302.1.59327 WP_001288302.1.59329 WP_001288302.1.59334 WP_001288302.1.59337 WP_001288302.1.59363 WP_001288302.1.5938 WP_001288302.1.59380 WP_001288302.1.59397 WP_001288302.1.59398 WP_001288302.1.5940 WP_001288302.1.59404 WP_001288302.1.59414 WP_001288302.1.59457 WP_001288302.1.59462 WP_001288302.1.59464 WP_001288302.1.59467 WP_001288302.1.59478 WP_001288302.1.59489 WP_001288302.1.59498 WP_001288302.1.59540 WP_001288302.1.59546 WP_001288302.1.59547 WP_001288302.1.59567 WP_001288302.1.59594 WP_001288302.1.59598 WP_001288302.1.59603 WP_001288302.1.59609 WP_001288302.1.59624 WP_001288302.1.59629 WP_001288302.1.59643 WP_001288302.1.59663 WP_001288302.1.59668 WP_001288302.1.59669 WP_001288302.1.59671 WP_001288302.1.59697 WP_001288302.1.5972 WP_001288302.1.59736 WP_001288302.1.59787 WP_001288302.1.59803 WP_001288302.1.59810 WP_001288302.1.59819 WP_001288302.1.5982 WP_001288302.1.59822 WP_001288302.1.59864 WP_001288302.1.59874 WP_001288302.1.59881 WP_001288302.1.59886 WP_001288302.1.59907 WP_001288302.1.59915 WP_001288302.1.59921 WP_001288302.1.59945 WP_001288302.1.59977 WP_001288302.1.60006 WP_001288302.1.60022 WP_001288302.1.6006 WP_001288302.1.60086 WP_001288302.1.60101 WP_001288302.1.6011 WP_001288302.1.60118 WP_001288302.1.60123 WP_001288302.1.60147 WP_001288302.1.60149 WP_001288302.1.60156 WP_001288302.1.60157 WP_001288302.1.60158 WP_001288302.1.60165 WP_001288302.1.6017 WP_001288302.1.60181 WP_001288302.1.602 WP_001288302.1.60201 WP_001288302.1.60227 WP_001288302.1.60251 WP_001288302.1.60259 WP_001288302.1.60280 WP_001288302.1.60289 WP_001288302.1.60302 WP_001288302.1.60307 WP_001288302.1.60339 WP_001288302.1.60345 WP_001288302.1.60353 WP_001288302.1.60355 WP_001288302.1.60360 WP_001288302.1.60368 WP_001288302.1.60431 WP_001288302.1.60434 WP_001288302.1.6045 WP_001288302.1.60462 WP_001288302.1.60492 WP_001288302.1.60515 WP_001288302.1.60547 WP_001288302.1.60551 WP_001288302.1.60585 WP_001288302.1.60594 WP_001288302.1.60595 WP_001288302.1.60636 WP_001288302.1.60641 WP_001288302.1.60690 WP_001288302.1.60696 WP_001288302.1.60704 WP_001288302.1.60719 WP_001288302.1.60730 WP_001288302.1.60734 WP_001288302.1.60742 WP_001288302.1.60750 WP_001288302.1.60751 WP_001288302.1.60758 WP_001288302.1.60759 WP_001288302.1.60765 WP_001288302.1.60778 WP_001288302.1.60787 WP_001288302.1.60813 WP_001288302.1.60820 WP_001288302.1.60845 WP_001288302.1.6085 WP_001288302.1.60859 WP_001288302.1.60869 WP_001288302.1.60888 WP_001288302.1.60898 WP_001288302.1.60912 WP_001288302.1.60917 WP_001288302.1.60923 WP_001288302.1.60934 WP_001288302.1.60939 WP_001288302.1.60946 WP_001288302.1.60948 WP_001288302.1.60965 WP_001288302.1.60981 WP_001288302.1.60982 WP_001288302.1.60991 WP_001288302.1.61009 WP_001288302.1.61013 WP_001288302.1.61019 WP_001288302.1.61023 WP_001288302.1.61026 WP_001288302.1.61029 WP_001288302.1.61030 WP_001288302.1.61031 WP_001288302.1.61082 WP_001288302.1.61107 WP_001288302.1.61115 WP_001288302.1.61119 WP_001288302.1.61139 WP_001288302.1.61152 WP_001288302.1.61153 WP_001288302.1.6118 WP_001288302.1.61188 WP_001288302.1.61189 WP_001288302.1.6119 WP_001288302.1.61224 WP_001288302.1.6123 WP_001288302.1.61257 WP_001288302.1.61263 WP_001288302.1.61271 WP_001288302.1.61286 WP_001288302.1.61313 WP_001288302.1.61316 WP_001288302.1.61318 WP_001288302.1.61324 WP_001288302.1.61327 WP_001288302.1.61339 WP_001288302.1.61346 WP_001288302.1.61353 WP_001288302.1.6136 WP_001288302.1.61375 WP_001288302.1.61393 WP_001288302.1.61394 WP_001288302.1.61408 WP_001288302.1.61413 WP_001288302.1.61421 WP_001288302.1.61430 WP_001288302.1.61439 WP_001288302.1.61440 WP_001288302.1.6149 WP_001288302.1.61515 WP_001288302.1.61534 WP_001288302.1.61547 WP_001288302.1.61555 WP_001288302.1.61585 WP_001288302.1.61591 WP_001288302.1.61597 WP_001288302.1.61615 WP_001288302.1.61639 WP_001288302.1.61653 WP_001288302.1.6166 WP_001288302.1.6168 WP_001288302.1.61705 WP_001288302.1.61709 WP_001288302.1.61713 WP_001288302.1.61749 WP_001288302.1.61776 WP_001288302.1.61784 WP_001288302.1.61800 WP_001288302.1.61802 WP_001288302.1.61831 WP_001288302.1.61838 WP_001288302.1.61843 WP_001288302.1.6188 WP_001288302.1.61897 WP_001288302.1.61899 WP_001288302.1.619 WP_001288302.1.61903 WP_001288302.1.61910 WP_001288302.1.61936 WP_001288302.1.61962 WP_001288302.1.61970 WP_001288302.1.61976 WP_001288302.1.61978 WP_001288302.1.62002 WP_001288302.1.6201 WP_001288302.1.62028 WP_001288302.1.62030 WP_001288302.1.62069 WP_001288302.1.62071 WP_001288302.1.6208 WP_001288302.1.62084 WP_001288302.1.62085 WP_001288302.1.62088 WP_001288302.1.62093 WP_001288302.1.62096 WP_001288302.1.62127 WP_001288302.1.62140 WP_001288302.1.62164 WP_001288302.1.62247 WP_001288302.1.62253 WP_001288302.1.62254 WP_001288302.1.62318 WP_001288302.1.6234 WP_001288302.1.62346 WP_001288302.1.62352 WP_001288302.1.62367 WP_001288302.1.62382 WP_001288302.1.62392 WP_001288302.1.62398 WP_001288302.1.62409 WP_001288302.1.62416 WP_001288302.1.62429 WP_001288302.1.62437 WP_001288302.1.62453 WP_001288302.1.62459 WP_001288302.1.62462 WP_001288302.1.62474 WP_001288302.1.62496 WP_001288302.1.62537 WP_001288302.1.62539 WP_001288302.1.62553 WP_001288302.1.62563 WP_001288302.1.62575 WP_001288302.1.62602 WP_001288302.1.62608 WP_001288302.1.62621 WP_001288302.1.62625 WP_001288302.1.62630 WP_001288302.1.62653 WP_001288302.1.6266 WP_001288302.1.62671 WP_001288302.1.62674 WP_001288302.1.6268 WP_001288302.1.62684 WP_001288302.1.62685 WP_001288302.1.62723 WP_001288302.1.62740 WP_001288302.1.62756 WP_001288302.1.62764 WP_001288302.1.62771 WP_001288302.1.62781 WP_001288302.1.62796 WP_001288302.1.62808 WP_001288302.1.62822 WP_001288302.1.62824 WP_001288302.1.62829 WP_001288302.1.62831 WP_001288302.1.62842 WP_001288302.1.62860 WP_001288302.1.62863 WP_001288302.1.62878 WP_001288302.1.62880 WP_001288302.1.62925 WP_001288302.1.62956 WP_001288302.1.62970 WP_001288302.1.63003 WP_001288302.1.63011 WP_001288302.1.63021 WP_001288302.1.63027 WP_001288302.1.63040 WP_001288302.1.63047 WP_001288302.1.63050 WP_001288302.1.63051 WP_001288302.1.63052 WP_001288302.1.63068 WP_001288302.1.63070 WP_001288302.1.63083 WP_001288302.1.631 WP_001288302.1.63107 WP_001288302.1.63120 WP_001288302.1.63131 WP_001288302.1.63132 WP_001288302.1.63139 WP_001288302.1.63140 WP_001288302.1.63143 WP_001288302.1.63170 WP_001288302.1.63182 WP_001288302.1.63190 WP_001288302.1.63195 WP_001288302.1.63215 WP_001288302.1.63220 WP_001288302.1.63228 WP_001288302.1.63233 WP_001288302.1.63244 WP_001288302.1.63255 WP_001288302.1.63266 WP_001288302.1.63273 WP_001288302.1.63279 WP_001288302.1.63288 WP_001288302.1.63289 WP_001288302.1.63296 WP_001288302.1.63304 WP_001288302.1.63307 WP_001288302.1.63313 WP_001288302.1.63319 WP_001288302.1.63322 WP_001288302.1.63324 WP_001288302.1.63333 WP_001288302.1.63335 WP_001288302.1.63337 WP_001288302.1.63341 WP_001288302.1.634 WP_001288302.1.63406 WP_001288302.1.63411 WP_001288302.1.63421 WP_001288302.1.63441 WP_001288302.1.63460 WP_001288302.1.63469 WP_001288302.1.63471 WP_001288302.1.63510 WP_001288302.1.63527 WP_001288302.1.63540 WP_001288302.1.6355 WP_001288302.1.63565 WP_001288302.1.63589 WP_001288302.1.63617 WP_001288302.1.63635 WP_001288302.1.63672 WP_001288302.1.63673 WP_001288302.1.63678 WP_001288302.1.63693 WP_001288302.1.63704 WP_001288302.1.63705 WP_001288302.1.63726 WP_001288302.1.63729 WP_001288302.1.63751 WP_001288302.1.63759 WP_001288302.1.63763 WP_001288302.1.63774 WP_001288302.1.6378 WP_001288302.1.63828 WP_001288302.1.63847 WP_001288302.1.63874 WP_001288302.1.63878 WP_001288302.1.6388 WP_001288302.1.63890 WP_001288302.1.63894 WP_001288302.1.63895 WP_001288302.1.63907 WP_001288302.1.63910 WP_001288302.1.63923 WP_001288302.1.63975 WP_001288302.1.63978 WP_001288302.1.63998 WP_001288302.1.64012 WP_001288302.1.6403 WP_001288302.1.64060 WP_001288302.1.6408 WP_001288302.1.64094 WP_001288302.1.64105 WP_001288302.1.64108 WP_001288302.1.64127 WP_001288302.1.64181 WP_001288302.1.64192 WP_001288302.1.642 WP_001288302.1.64207 WP_001288302.1.64232 WP_001288302.1.64234 WP_001288302.1.64250 WP_001288302.1.64251 WP_001288302.1.64279 WP_001288302.1.64288 WP_001288302.1.64303 WP_001288302.1.64304 WP_001288302.1.64334 WP_001288302.1.64367 WP_001288302.1.64368 WP_001288302.1.6438 WP_001288302.1.64396 WP_001288302.1.64400 WP_001288302.1.64408 WP_001288302.1.64434 WP_001288302.1.64440 WP_001288302.1.64446 WP_001288302.1.64456 WP_001288302.1.64457 WP_001288302.1.64473 WP_001288302.1.645 WP_001288302.1.64525 WP_001288302.1.6453 WP_001288302.1.64537 WP_001288302.1.64549 WP_001288302.1.64565 WP_001288302.1.64583 WP_001288302.1.6459 WP_001288302.1.6462 WP_001288302.1.64628 WP_001288302.1.64630 WP_001288302.1.64631 WP_001288302.1.64643 WP_001288302.1.64665 WP_001288302.1.64677 WP_001288302.1.64686 WP_001288302.1.64720 WP_001288302.1.64765 WP_001288302.1.6479 WP_001288302.1.64811 WP_001288302.1.64845 WP_001288302.1.64858 WP_001288302.1.64860 WP_001288302.1.64879 WP_001288302.1.6488 WP_001288302.1.64893 WP_001288302.1.64897 WP_001288302.1.64911 WP_001288302.1.64928 WP_001288302.1.64935 WP_001288302.1.64951 WP_001288302.1.64956 WP_001288302.1.64961 WP_001288302.1.64988 WP_001288302.1.64994 WP_001288302.1.64996 WP_001288302.1.64998 WP_001288302.1.65025 WP_001288302.1.65033 WP_001288302.1.65038 WP_001288302.1.65044 WP_001288302.1.65046 WP_001288302.1.65076 WP_001288302.1.65082 WP_001288302.1.6509 WP_001288302.1.65125 WP_001288302.1.65132 WP_001288302.1.65158 WP_001288302.1.65164 WP_001288302.1.65180 WP_001288302.1.65193 WP_001288302.1.65203 WP_001288302.1.65217 WP_001288302.1.65233 WP_001288302.1.65243 WP_001288302.1.65264 WP_001288302.1.65274 WP_001288302.1.6531 WP_001288302.1.65317 WP_001288302.1.65346 WP_001288302.1.65358 WP_001288302.1.65367 WP_001288302.1.65387 WP_001288302.1.65406 WP_001288302.1.65407 WP_001288302.1.65419 WP_001288302.1.65423 WP_001288302.1.65432 WP_001288302.1.6544 WP_001288302.1.65443 WP_001288302.1.65448 WP_001288302.1.65451 WP_001288302.1.6547 WP_001288302.1.65504 WP_001288302.1.6551 WP_001288302.1.65512 WP_001288302.1.65520 WP_001288302.1.65544 WP_001288302.1.65562 WP_001288302.1.65585 WP_001288302.1.6559 WP_001288302.1.65599 WP_001288302.1.65600 WP_001288302.1.65616 WP_001288302.1.65629 WP_001288302.1.65643 WP_001288302.1.65656 WP_001288302.1.65675 WP_001288302.1.6568 WP_001288302.1.65689 WP_001288302.1.65693 WP_001288302.1.65700 WP_001288302.1.65703 WP_001288302.1.65704 WP_001288302.1.65705 WP_001288302.1.65713 WP_001288302.1.65717 WP_001288302.1.65734 WP_001288302.1.65769 WP_001288302.1.6578 WP_001288302.1.65809 WP_001288302.1.6585 WP_001288302.1.65856 WP_001288302.1.65870 WP_001288302.1.65879 WP_001288302.1.65886 WP_001288302.1.65892 WP_001288302.1.65922 WP_001288302.1.65928 WP_001288302.1.65930 WP_001288302.1.65931 WP_001288302.1.65935 WP_001288302.1.65946 WP_001288302.1.65947 WP_001288302.1.65948 WP_001288302.1.65965 WP_001288302.1.65986 WP_001288302.1.65990 WP_001288302.1.66009 WP_001288302.1.66014 WP_001288302.1.6603 WP_001288302.1.66054 WP_001288302.1.66056 WP_001288302.1.66069 WP_001288302.1.66073 WP_001288302.1.66081 WP_001288302.1.661 WP_001288302.1.6612 WP_001288302.1.66120 WP_001288302.1.66130 WP_001288302.1.66133 WP_001288302.1.66144 WP_001288302.1.66175 WP_001288302.1.66227 WP_001288302.1.66262 WP_001288302.1.66265 WP_001288302.1.66287 WP_001288302.1.66298 WP_001288302.1.66302 WP_001288302.1.6632 WP_001288302.1.66322 WP_001288302.1.66328 WP_001288302.1.66366 WP_001288302.1.66433 WP_001288302.1.66453 WP_001288302.1.66482 WP_001288302.1.66505 WP_001288302.1.66513 WP_001288302.1.66518 WP_001288302.1.66519 WP_001288302.1.66542 WP_001288302.1.66556 WP_001288302.1.66564 WP_001288302.1.66588 WP_001288302.1.66598 WP_001288302.1.66601 WP_001288302.1.66606 WP_001288302.1.66611 WP_001288302.1.66614 WP_001288302.1.6662 WP_001288302.1.66628 WP_001288302.1.66645 WP_001288302.1.66664 WP_001288302.1.66677 WP_001288302.1.6668 WP_001288302.1.66690 WP_001288302.1.66705 WP_001288302.1.66711 WP_001288302.1.66726 WP_001288302.1.6674 WP_001288302.1.66756 WP_001288302.1.66765 WP_001288302.1.66766 WP_001288302.1.66786 WP_001288302.1.66792 WP_001288302.1.66803 WP_001288302.1.66816 WP_001288302.1.66818 WP_001288302.1.6684 WP_001288302.1.66853 WP_001288302.1.66879 WP_001288302.1.6688 WP_001288302.1.66904 WP_001288302.1.66906 WP_001288302.1.66938 WP_001288302.1.66969 WP_001288302.1.66996 WP_001288302.1.6700 WP_001288302.1.67012 WP_001288302.1.67014 WP_001288302.1.67016 WP_001288302.1.67063 WP_001288302.1.67067 WP_001288302.1.67072 WP_001288302.1.67112 WP_001288302.1.67113 WP_001288302.1.67135 WP_001288302.1.67147 WP_001288302.1.67152 WP_001288302.1.67155 WP_001288302.1.67160 WP_001288302.1.67191 WP_001288302.1.67212 WP_001288302.1.6722 WP_001288302.1.67238 WP_001288302.1.67251 WP_001288302.1.67259 WP_001288302.1.6726 WP_001288302.1.67266 WP_001288302.1.67286 WP_001288302.1.67294 WP_001288302.1.67296 WP_001288302.1.67312 WP_001288302.1.67328 WP_001288302.1.67329 WP_001288302.1.67333 WP_001288302.1.67375 WP_001288302.1.67379 WP_001288302.1.67384 WP_001288302.1.6740 WP_001288302.1.67414 WP_001288302.1.67418 WP_001288302.1.67420 WP_001288302.1.67425 WP_001288302.1.67447 WP_001288302.1.67457 WP_001288302.1.67460 WP_001288302.1.67463 WP_001288302.1.67480 WP_001288302.1.67505 WP_001288302.1.67507 WP_001288302.1.67520 WP_001288302.1.67521 WP_001288302.1.67540 WP_001288302.1.67554 WP_001288302.1.67571 WP_001288302.1.67572 WP_001288302.1.67620 WP_001288302.1.67621 WP_001288302.1.67632 WP_001288302.1.67644 WP_001288302.1.67651 WP_001288302.1.67653 WP_001288302.1.67691 WP_001288302.1.67712 WP_001288302.1.67713 WP_001288302.1.67722 WP_001288302.1.67754 WP_001288302.1.67762 WP_001288302.1.67798 WP_001288302.1.67800 WP_001288302.1.67806 WP_001288302.1.67808 WP_001288302.1.67815 WP_001288302.1.67834 WP_001288302.1.6786 WP_001288302.1.67864 WP_001288302.1.67865 WP_001288302.1.67867 WP_001288302.1.67880 WP_001288302.1.67900 WP_001288302.1.67925 WP_001288302.1.67931 WP_001288302.1.67986 WP_001288302.1.67991 WP_001288302.1.68020 WP_001288302.1.68033 WP_001288302.1.68054 WP_001288302.1.68066 WP_001288302.1.68101 WP_001288302.1.6811 WP_001288302.1.68111 WP_001288302.1.68134 WP_001288302.1.68139 WP_001288302.1.68141 WP_001288302.1.68152 WP_001288302.1.68160 WP_001288302.1.68161 WP_001288302.1.68199 WP_001288302.1.68202 WP_001288302.1.68221 WP_001288302.1.68223 WP_001288302.1.68233 WP_001288302.1.6824 WP_001288302.1.68261 WP_001288302.1.68268 WP_001288302.1.68286 WP_001288302.1.68295 WP_001288302.1.68296 WP_001288302.1.68299 WP_001288302.1.6830 WP_001288302.1.68307 WP_001288302.1.68334 WP_001288302.1.6834 WP_001288302.1.68343 WP_001288302.1.68351 WP_001288302.1.68355 WP_001288302.1.68366 WP_001288302.1.68367 WP_001288302.1.6839 WP_001288302.1.68392 WP_001288302.1.68397 WP_001288302.1.68398 WP_001288302.1.68399 WP_001288302.1.68404 WP_001288302.1.68425 WP_001288302.1.68466 WP_001288302.1.68476 WP_001288302.1.68479 WP_001288302.1.68483 WP_001288302.1.68489 WP_001288302.1.68504 WP_001288302.1.68505 WP_001288302.1.68512 WP_001288302.1.68522 WP_001288302.1.68548 WP_001288302.1.68565 WP_001288302.1.686 WP_001288302.1.68636 WP_001288302.1.68650 WP_001288302.1.68657 WP_001288302.1.68681 WP_001288302.1.68683 WP_001288302.1.68699 WP_001288302.1.68703 WP_001288302.1.68716 WP_001288302.1.68728 WP_001288302.1.68737 WP_001288302.1.68741 WP_001288302.1.68743 WP_001288302.1.68747 WP_001288302.1.68773 WP_001288302.1.68775 WP_001288302.1.68813 WP_001288302.1.68831 WP_001288302.1.68854 WP_001288302.1.68864 WP_001288302.1.68875 WP_001288302.1.68878 WP_001288302.1.68883 WP_001288302.1.68931 WP_001288302.1.68943 WP_001288302.1.68944 WP_001288302.1.68987 WP_001288302.1.68988 WP_001288302.1.68998 WP_001288302.1.69012 WP_001288302.1.69016 WP_001288302.1.69045 WP_001288302.1.69071 WP_001288302.1.69078 WP_001288302.1.69087 WP_001288302.1.69089 WP_001288302.1.691 WP_001288302.1.69105 WP_001288302.1.69120 WP_001288302.1.69147 WP_001288302.1.6915 WP_001288302.1.69162 WP_001288302.1.6917 WP_001288302.1.69179 WP_001288302.1.69191 WP_001288302.1.69198 WP_001288302.1.69213 WP_001288302.1.69219 WP_001288302.1.69222 WP_001288302.1.69232 WP_001288302.1.69237 WP_001288302.1.69239 WP_001288302.1.69251 WP_001288302.1.69266 WP_001288302.1.69349 WP_001288302.1.69361 WP_001288302.1.69366 WP_001288302.1.69394 WP_001288302.1.69395 WP_001288302.1.69409 WP_001288302.1.69412 WP_001288302.1.69415 WP_001288302.1.69434 WP_001288302.1.69437 WP_001288302.1.69475 WP_001288302.1.69476 WP_001288302.1.69480 WP_001288302.1.69483 WP_001288302.1.69489 WP_001288302.1.69490 WP_001288302.1.695 WP_001288302.1.69520 WP_001288302.1.6953 WP_001288302.1.69546 WP_001288302.1.69552 WP_001288302.1.69559 WP_001288302.1.69563 WP_001288302.1.69598 WP_001288302.1.69622 WP_001288302.1.69639 WP_001288302.1.69679 WP_001288302.1.6968 WP_001288302.1.69683 WP_001288302.1.69721 WP_001288302.1.69724 WP_001288302.1.69734 WP_001288302.1.6980 WP_001288302.1.69820 WP_001288302.1.69823 WP_001288302.1.69830 WP_001288302.1.69877 WP_001288302.1.69878 WP_001288302.1.69882 WP_001288302.1.699 WP_001288302.1.69902 WP_001288302.1.69921 WP_001288302.1.69934 WP_001288302.1.69980 WP_001288302.1.69987 WP_001288302.1.69995 WP_001288302.1.70024 WP_001288302.1.70048 WP_001288302.1.70059 WP_001288302.1.70089 WP_001288302.1.70094 WP_001288302.1.70105 WP_001288302.1.7012 WP_001288302.1.70133 WP_001288302.1.70161 WP_001288302.1.70210 WP_001288302.1.70220 WP_001288302.1.70225 WP_001288302.1.70228 WP_001288302.1.7024 WP_001288302.1.70253 WP_001288302.1.70266 WP_001288302.1.70273 WP_001288302.1.70294 WP_001288302.1.703 WP_001288302.1.70311 WP_001288302.1.70313 WP_001288302.1.70334 WP_001288302.1.7034 WP_001288302.1.70344 WP_001288302.1.70349 WP_001288302.1.70353 WP_001288302.1.70413 WP_001288302.1.7043 WP_001288302.1.70441 WP_001288302.1.70448 WP_001288302.1.70451 WP_001288302.1.70457 WP_001288302.1.70459 WP_001288302.1.7046 WP_001288302.1.70462 WP_001288302.1.70487 WP_001288302.1.70495 WP_001288302.1.70527 WP_001288302.1.7053 WP_001288302.1.70541 WP_001288302.1.70546 WP_001288302.1.70554 WP_001288302.1.70558 WP_001288302.1.70564 WP_001288302.1.706 WP_001288302.1.7061 WP_001288302.1.70611 WP_001288302.1.70635 WP_001288302.1.7064 WP_001288302.1.70641 WP_001288302.1.70664 WP_001288302.1.7067 WP_001288302.1.70672 WP_001288302.1.707 WP_001288302.1.70721 WP_001288302.1.7073 WP_001288302.1.70763 WP_001288302.1.70807 WP_001288302.1.70808 WP_001288302.1.70818 WP_001288302.1.70823 WP_001288302.1.70829 WP_001288302.1.70835 WP_001288302.1.70843 WP_001288302.1.70850 WP_001288302.1.70855 WP_001288302.1.7089 WP_001288302.1.70909 WP_001288302.1.70924 WP_001288302.1.70926 WP_001288302.1.70930 WP_001288302.1.70939 WP_001288302.1.70943 WP_001288302.1.70994 WP_001288302.1.710 WP_001288302.1.71016 WP_001288302.1.71027 WP_001288302.1.71043 WP_001288302.1.7105 WP_001288302.1.71058 WP_001288302.1.71059 WP_001288302.1.71073 WP_001288302.1.7109 WP_001288302.1.71130 WP_001288302.1.71143 WP_001288302.1.71179 WP_001288302.1.71182 WP_001288302.1.71196 WP_001288302.1.7120 WP_001288302.1.71208 WP_001288302.1.71231 WP_001288302.1.71236 WP_001288302.1.7125 WP_001288302.1.71257 WP_001288302.1.71266 WP_001288302.1.71267 WP_001288302.1.71280 WP_001288302.1.71295 WP_001288302.1.71298 WP_001288302.1.71301 WP_001288302.1.71313 WP_001288302.1.71316 WP_001288302.1.71325 WP_001288302.1.71345 WP_001288302.1.71359 WP_001288302.1.71410 WP_001288302.1.71416 WP_001288302.1.71419 WP_001288302.1.71428 WP_001288302.1.71438 WP_001288302.1.71463 WP_001288302.1.71466 WP_001288302.1.71467 WP_001288302.1.71475 WP_001288302.1.71483 WP_001288302.1.7150 WP_001288302.1.71519 WP_001288302.1.71529 WP_001288302.1.71541 WP_001288302.1.71543 WP_001288302.1.71547 WP_001288302.1.71572 WP_001288302.1.71575 WP_001288302.1.7158 WP_001288302.1.71590 WP_001288302.1.71596 WP_001288302.1.71602 WP_001288302.1.7161 WP_001288302.1.7164 WP_001288302.1.71662 WP_001288302.1.71676 WP_001288302.1.71707 WP_001288302.1.71715 WP_001288302.1.71721 WP_001288302.1.71735 WP_001288302.1.71737 WP_001288302.1.71739 WP_001288302.1.71741 WP_001288302.1.71771 WP_001288302.1.71780 WP_001288302.1.7179 WP_001288302.1.71800 WP_001288302.1.71828 WP_001288302.1.71836 WP_001288302.1.71861 WP_001288302.1.71863 WP_001288302.1.71877 WP_001288302.1.71892 WP_001288302.1.71899 WP_001288302.1.71910 WP_001288302.1.71925 WP_001288302.1.7193 WP_001288302.1.71978 WP_001288302.1.71981 WP_001288302.1.71989 WP_001288302.1.72002 WP_001288302.1.72018 WP_001288302.1.72026 WP_001288302.1.72031 WP_001288302.1.72067 WP_001288302.1.72085 WP_001288302.1.72102 WP_001288302.1.72112 WP_001288302.1.72148 WP_001288302.1.72169 WP_001288302.1.72176 WP_001288302.1.722 WP_001288302.1.72204 WP_001288302.1.72205 WP_001288302.1.72224 WP_001288302.1.72257 WP_001288302.1.72271 WP_001288302.1.72285 WP_001288302.1.72306 WP_001288302.1.72315 WP_001288302.1.72330 WP_001288302.1.72340 WP_001288302.1.72347 WP_001288302.1.7236 WP_001288302.1.72363 WP_001288302.1.72366 WP_001288302.1.72371 WP_001288302.1.72424 WP_001288302.1.72446 WP_001288302.1.72453 WP_001288302.1.72465 WP_001288302.1.72478 WP_001288302.1.72489 WP_001288302.1.72496 WP_001288302.1.72497 WP_001288302.1.72529 WP_001288302.1.7254 WP_001288302.1.72547 WP_001288302.1.72564 WP_001288302.1.7258 WP_001288302.1.7260 WP_001288302.1.72626 WP_001288302.1.72649 WP_001288302.1.72654 WP_001288302.1.72666 WP_001288302.1.72708 WP_001288302.1.72719 WP_001288302.1.72750 WP_001288302.1.72753 WP_001288302.1.72760 WP_001288302.1.72762 WP_001288302.1.72787 WP_001288302.1.72816 WP_001288302.1.72832 WP_001288302.1.72834 WP_001288302.1.72835 WP_001288302.1.72874 WP_001288302.1.72881 WP_001288302.1.72903 WP_001288302.1.72904 WP_001288302.1.72930 WP_001288302.1.72935 WP_001288302.1.7294 WP_001288302.1.72945 WP_001288302.1.72961 WP_001288302.1.72965 WP_001288302.1.72991 WP_001288302.1.73002 WP_001288302.1.73017 WP_001288302.1.73019 WP_001288302.1.73021 WP_001288302.1.73022 WP_001288302.1.73037 WP_001288302.1.73046 WP_001288302.1.73087 WP_001288302.1.73121 WP_001288302.1.73122 WP_001288302.1.73132 WP_001288302.1.73140 WP_001288302.1.73190 WP_001288302.1.73191 WP_001288302.1.73195 WP_001288302.1.73201 WP_001288302.1.73211 WP_001288302.1.73240 WP_001288302.1.73241 WP_001288302.1.73246 WP_001288302.1.7326 WP_001288302.1.73264 WP_001288302.1.73265 WP_001288302.1.73286 WP_001288302.1.73386 WP_001288302.1.73401 WP_001288302.1.73402 WP_001288302.1.73420 WP_001288302.1.73444 WP_001288302.1.73450 WP_001288302.1.73456 WP_001288302.1.73464 WP_001288302.1.73489 WP_001288302.1.73501 WP_001288302.1.73513 WP_001288302.1.73536 WP_001288302.1.73539 WP_001288302.1.73547 WP_001288302.1.73571 WP_001288302.1.73591 WP_001288302.1.736 WP_001288302.1.7360 WP_001288302.1.73610 WP_001288302.1.73639 WP_001288302.1.73640 WP_001288302.1.7365 WP_001288302.1.73674 WP_001288302.1.73685 WP_001288302.1.73687 WP_001288302.1.73693 WP_001288302.1.73694 WP_001288302.1.73735 WP_001288302.1.73740 WP_001288302.1.73759 WP_001288302.1.73786 WP_001288302.1.73789 WP_001288302.1.7380 WP_001288302.1.73834 WP_001288302.1.73837 WP_001288302.1.73853 WP_001288302.1.73858 WP_001288302.1.73868 WP_001288302.1.73885 WP_001288302.1.73900 WP_001288302.1.73902 WP_001288302.1.73910 WP_001288302.1.73920 WP_001288302.1.73921 WP_001288302.1.73940 WP_001288302.1.73949 WP_001288302.1.73961 WP_001288302.1.73969 WP_001288302.1.73971 WP_001288302.1.73976 WP_001288302.1.73983 WP_001288302.1.74004 WP_001288302.1.74006 WP_001288302.1.7401 WP_001288302.1.74010 WP_001288302.1.74025 WP_001288302.1.74027 WP_001288302.1.7406 WP_001288302.1.74073 WP_001288302.1.74081 WP_001288302.1.74085 WP_001288302.1.74088 WP_001288302.1.74138 WP_001288302.1.74155 WP_001288302.1.74157 WP_001288302.1.74161 WP_001288302.1.74172 WP_001288302.1.74173 WP_001288302.1.74183 WP_001288302.1.74216 WP_001288302.1.74221 WP_001288302.1.74234 WP_001288302.1.74237 WP_001288302.1.74242 WP_001288302.1.74257 WP_001288302.1.7427 WP_001288302.1.74273 WP_001288302.1.74284 WP_001288302.1.74295 WP_001288302.1.74327 WP_001288302.1.7434 WP_001288302.1.74353 WP_001288302.1.74356 WP_001288302.1.74380 WP_001288302.1.74390 WP_001288302.1.74429 WP_001288302.1.74456 WP_001288302.1.74457 WP_001288302.1.74468 WP_001288302.1.74474 WP_001288302.1.74497 WP_001288302.1.74510 WP_001288302.1.74533 WP_001288302.1.7457 WP_001288302.1.74576 WP_001288302.1.74587 WP_001288302.1.74590 WP_001288302.1.74610 WP_001288302.1.74638 WP_001288302.1.74645 WP_001288302.1.74676 WP_001288302.1.74681 WP_001288302.1.74693 WP_001288302.1.74696 WP_001288302.1.74704 WP_001288302.1.74731 WP_001288302.1.74747 WP_001288302.1.74758 WP_001288302.1.74761 WP_001288302.1.74770 WP_001288302.1.74775 WP_001288302.1.74785 WP_001288302.1.74797 WP_001288302.1.74802 WP_001288302.1.74808 WP_001288302.1.7482 WP_001288302.1.74840 WP_001288302.1.74846 WP_001288302.1.74866 WP_001288302.1.74874 WP_001288302.1.74890 WP_001288302.1.74899 WP_001288302.1.74911 WP_001288302.1.74922 WP_001288302.1.74924 WP_001288302.1.74961 WP_001288302.1.74978 WP_001288302.1.74985 WP_001288302.1.74994 WP_001288302.1.74999 WP_001288302.1.75038 WP_001288302.1.75044 WP_001288302.1.75048 WP_001288302.1.75052 WP_001288302.1.75070 WP_001288302.1.75093 WP_001288302.1.75111 WP_001288302.1.75127 WP_001288302.1.75131 WP_001288302.1.75132 WP_001288302.1.75141 WP_001288302.1.75186 WP_001288302.1.75227 WP_001288302.1.75252 WP_001288302.1.75253 WP_001288302.1.75294 WP_001288302.1.75298 WP_001288302.1.75304 WP_001288302.1.75320 WP_001288302.1.75323 WP_001288302.1.75327 WP_001288302.1.75349 WP_001288302.1.75351 WP_001288302.1.75356 WP_001288302.1.75365 WP_001288302.1.75375 WP_001288302.1.75379 WP_001288302.1.75399 WP_001288302.1.75409 WP_001288302.1.7542 WP_001288302.1.75438 WP_001288302.1.75440 WP_001288302.1.75521 WP_001288302.1.75527 WP_001288302.1.75538 WP_001288302.1.75551 WP_001288302.1.75566 WP_001288302.1.75571 WP_001288302.1.75590 WP_001288302.1.7561 WP_001288302.1.75647 WP_001288302.1.75649 WP_001288302.1.75652 WP_001288302.1.75680 WP_001288302.1.75685 WP_001288302.1.75692 WP_001288302.1.75704 WP_001288302.1.75728 WP_001288302.1.75743 WP_001288302.1.75769 WP_001288302.1.75775 WP_001288302.1.758 WP_001288302.1.75800 WP_001288302.1.75805 WP_001288302.1.75809 WP_001288302.1.75830 WP_001288302.1.75840 WP_001288302.1.75848 WP_001288302.1.75851 WP_001288302.1.75862 WP_001288302.1.75881 WP_001288302.1.75885 WP_001288302.1.75910 WP_001288302.1.75929 WP_001288302.1.75944 WP_001288302.1.75952 WP_001288302.1.75956 WP_001288302.1.7596 WP_001288302.1.75969 WP_001288302.1.76010 WP_001288302.1.76013 WP_001288302.1.76015 WP_001288302.1.7602 WP_001288302.1.76047 WP_001288302.1.76049 WP_001288302.1.76053 WP_001288302.1.7607 WP_001288302.1.76095 WP_001288302.1.76104 WP_001288302.1.76111 WP_001288302.1.76114 WP_001288302.1.76121 WP_001288302.1.76123 WP_001288302.1.76143 WP_001288302.1.76149 WP_001288302.1.76153 WP_001288302.1.76179 WP_001288302.1.76230 WP_001288302.1.76234 WP_001288302.1.7624 WP_001288302.1.7625 WP_001288302.1.76258 WP_001288302.1.76261 WP_001288302.1.7627 WP_001288302.1.76283 WP_001288302.1.76294 WP_001288302.1.76295 WP_001288302.1.76313 WP_001288302.1.76332 WP_001288302.1.76337 WP_001288302.1.76351 WP_001288302.1.76411 WP_001288302.1.76419 WP_001288302.1.76420 WP_001288302.1.76421 WP_001288302.1.76424 WP_001288302.1.76426 WP_001288302.1.76431 WP_001288302.1.76463 WP_001288302.1.76482 WP_001288302.1.76497 WP_001288302.1.765 WP_001288302.1.76528 WP_001288302.1.7658 WP_001288302.1.76606 WP_001288302.1.76624 WP_001288302.1.76648 WP_001288302.1.76659 WP_001288302.1.76674 WP_001288302.1.76686 WP_001288302.1.76689 WP_001288302.1.76690 WP_001288302.1.76693 WP_001288302.1.76711 WP_001288302.1.76718 WP_001288302.1.7675 WP_001288302.1.76790 WP_001288302.1.76792 WP_001288302.1.76798 WP_001288302.1.768 WP_001288302.1.76803 WP_001288302.1.76816 WP_001288302.1.76820 WP_001288302.1.76825 WP_001288302.1.76829 WP_001288302.1.76839 WP_001288302.1.76845 WP_001288302.1.76869 WP_001288302.1.76872 WP_001288302.1.76876 WP_001288302.1.76878 WP_001288302.1.76895 WP_001288302.1.76897 WP_001288302.1.76920 WP_001288302.1.76921 WP_001288302.1.76937 WP_001288302.1.7694 WP_001288302.1.76944 WP_001288302.1.76952 WP_001288302.1.76998 WP_001288302.1.77013 WP_001288302.1.77020 WP_001288302.1.77031 WP_001288302.1.77041 WP_001288302.1.77043 WP_001288302.1.77050 WP_001288302.1.77060 WP_001288302.1.77062 WP_001288302.1.77069 WP_001288302.1.77072 WP_001288302.1.77112 WP_001288302.1.77137 WP_001288302.1.77144 WP_001288302.1.77145 WP_001288302.1.77158 WP_001288302.1.77183 WP_001288302.1.77187 WP_001288302.1.77190 WP_001288302.1.77203 WP_001288302.1.77229 WP_001288302.1.77256 WP_001288302.1.77297 WP_001288302.1.77298 WP_001288302.1.77305 WP_001288302.1.77315 WP_001288302.1.77331 WP_001288302.1.77346 WP_001288302.1.77359 WP_001288302.1.77388 WP_001288302.1.77416 WP_001288302.1.77426 WP_001288302.1.7745 WP_001288302.1.7746 WP_001288302.1.77460 WP_001288302.1.77485 WP_001288302.1.77489 WP_001288302.1.77497 WP_001288302.1.77498 WP_001288302.1.7752 WP_001288302.1.77520 WP_001288302.1.77527 WP_001288302.1.77532 WP_001288302.1.77533 WP_001288302.1.77536 WP_001288302.1.77572 WP_001288302.1.77583 WP_001288302.1.77603 WP_001288302.1.77606 WP_001288302.1.77650 WP_001288302.1.77733 WP_001288302.1.77735 WP_001288302.1.77738 WP_001288302.1.7774 WP_001288302.1.77743 WP_001288302.1.77763 WP_001288302.1.77791 WP_001288302.1.77814 WP_001288302.1.77818 WP_001288302.1.77822 WP_001288302.1.77848 WP_001288302.1.7785 WP_001288302.1.77858 WP_001288302.1.7786 WP_001288302.1.77860 WP_001288302.1.7787 WP_001288302.1.77882 WP_001288302.1.77883 WP_001288302.1.77893 WP_001288302.1.77915 WP_001288302.1.77922 WP_001288302.1.77930 WP_001288302.1.77952 WP_001288302.1.77957 WP_001288302.1.77986 WP_001288302.1.78038 WP_001288302.1.78054 WP_001288302.1.78067 WP_001288302.1.78082 WP_001288302.1.78091 WP_001288302.1.7810 WP_001288302.1.78116 WP_001288302.1.78164 WP_001288302.1.78173 WP_001288302.1.78179 WP_001288302.1.78189 WP_001288302.1.78194 WP_001288302.1.78207 WP_001288302.1.78208 WP_001288302.1.78210 WP_001288302.1.78252 WP_001288302.1.78254 WP_001288302.1.78257 WP_001288302.1.7827 WP_001288302.1.78304 WP_001288302.1.78311 WP_001288302.1.78324 WP_001288302.1.7833 WP_001288302.1.78330 WP_001288302.1.78332 WP_001288302.1.78335 WP_001288302.1.78365 WP_001288302.1.78371 WP_001288302.1.78392 WP_001288302.1.78404 WP_001288302.1.78434 WP_001288302.1.78436 WP_001288302.1.78470 WP_001288302.1.78478 WP_001288302.1.78494 WP_001288302.1.7850 WP_001288302.1.78513 WP_001288302.1.7853 WP_001288302.1.7857 WP_001288302.1.78573 WP_001288302.1.78585 WP_001288302.1.78592 WP_001288302.1.78598 WP_001288302.1.78604 WP_001288302.1.78638 WP_001288302.1.78653 WP_001288302.1.78662 WP_001288302.1.78667 WP_001288302.1.7868 WP_001288302.1.78685 WP_001288302.1.78708 WP_001288302.1.78728 WP_001288302.1.78731 WP_001288302.1.78736 WP_001288302.1.78763 WP_001288302.1.78785 WP_001288302.1.78803 WP_001288302.1.78816 WP_001288302.1.78819 WP_001288302.1.78841 WP_001288302.1.78897 WP_001288302.1.78920 WP_001288302.1.78937 WP_001288302.1.78946 WP_001288302.1.78978 WP_001288302.1.78983 WP_001288302.1.78985 WP_001288302.1.78991 WP_001288302.1.78995 WP_001288302.1.7900 WP_001288302.1.79006 WP_001288302.1.79037 WP_001288302.1.79038 WP_001288302.1.7905 WP_001288302.1.79051 WP_001288302.1.79059 WP_001288302.1.79085 WP_001288302.1.79110 WP_001288302.1.79131 WP_001288302.1.79132 WP_001288302.1.7914 WP_001288302.1.79143 WP_001288302.1.79156 WP_001288302.1.79170 WP_001288302.1.79178 WP_001288302.1.79192 WP_001288302.1.79197 WP_001288302.1.79208 WP_001288302.1.79223 WP_001288302.1.79270 WP_001288302.1.79275 WP_001288302.1.79285 WP_001288302.1.7930 WP_001288302.1.7931 WP_001288302.1.79310 WP_001288302.1.79314 WP_001288302.1.79322 WP_001288302.1.79332 WP_001288302.1.79334 WP_001288302.1.7934 WP_001288302.1.79341 WP_001288302.1.79367 WP_001288302.1.79374 WP_001288302.1.79378 WP_001288302.1.79400 WP_001288302.1.79402 WP_001288302.1.79407 WP_001288302.1.79408 WP_001288302.1.79436 WP_001288302.1.79452 WP_001288302.1.79461 WP_001288302.1.79476 WP_001288302.1.79487 WP_001288302.1.79539 WP_001288302.1.79552 WP_001288302.1.79554 WP_001288302.1.79556 WP_001288302.1.79566 WP_001288302.1.79581 WP_001288302.1.79626 WP_001288302.1.79627 WP_001288302.1.79638 WP_001288302.1.79662 WP_001288302.1.79664 WP_001288302.1.79672 WP_001288302.1.79676 WP_001288302.1.79677 WP_001288302.1.79706 WP_001288302.1.79731 WP_001288302.1.79737 WP_001288302.1.79763 WP_001288302.1.7981 WP_001288302.1.79815 WP_001288302.1.79822 WP_001288302.1.79831 WP_001288302.1.79834 WP_001288302.1.79837 WP_001288302.1.79854 WP_001288302.1.79855 WP_001288302.1.7989 WP_001288302.1.79896 WP_001288302.1.79904 WP_001288302.1.79911 WP_001288302.1.7992 WP_001288302.1.79941 WP_001288302.1.79949 WP_001288302.1.79961 WP_001288302.1.79971 WP_001288302.1.79991 WP_001288302.1.80000 WP_001288302.1.80009 WP_001288302.1.80013 WP_001288302.1.80029 WP_001288302.1.80032 WP_001288302.1.80042 WP_001288302.1.80079 WP_001288302.1.80086 WP_001288302.1.80109 WP_001288302.1.80119 WP_001288302.1.80120 WP_001288302.1.80122 WP_001288302.1.80124 WP_001288302.1.80127 WP_001288302.1.80146 WP_001288302.1.80152 WP_001288302.1.80178 WP_001288302.1.80181 WP_001288302.1.80184 WP_001288302.1.80193 WP_001288302.1.80203 WP_001288302.1.80206 WP_001288302.1.80210 WP_001288302.1.80244 WP_001288302.1.80274 WP_001288302.1.80286 WP_001288302.1.80287 WP_001288302.1.80290 WP_001288302.1.80297 WP_001288302.1.8030 WP_001288302.1.80308 WP_001288302.1.8031 WP_001288302.1.80316 WP_001288302.1.80317 WP_001288302.1.80318 WP_001288302.1.80345 WP_001288302.1.8035 WP_001288302.1.80358 WP_001288302.1.80361 WP_001288302.1.80378 WP_001288302.1.80389 WP_001288302.1.80393 WP_001288302.1.8040 WP_001288302.1.80407 WP_001288302.1.80414 WP_001288302.1.8043 WP_001288302.1.80430 WP_001288302.1.80434 WP_001288302.1.8045 WP_001288302.1.80472 WP_001288302.1.80521 WP_001288302.1.80530 WP_001288302.1.80582 WP_001288302.1.80647 WP_001288302.1.8065 WP_001288302.1.80653 WP_001288302.1.80680 WP_001288302.1.80687 WP_001288302.1.80717 WP_001288302.1.80734 WP_001288302.1.80745 WP_001288302.1.80761 WP_001288302.1.80762 WP_001288302.1.80763 WP_001288302.1.8077 WP_001288302.1.80781 WP_001288302.1.80786 WP_001288302.1.80833 WP_001288302.1.8084 WP_001288302.1.80845 WP_001288302.1.80855 WP_001288302.1.80872 WP_001288302.1.80899 WP_001288302.1.809 WP_001288302.1.80962 WP_001288302.1.80972 WP_001288302.1.81010 WP_001288302.1.81022 WP_001288302.1.81049 WP_001288302.1.81052 WP_001288302.1.81055 WP_001288302.1.81064 WP_001288302.1.81065 WP_001288302.1.81085 WP_001288302.1.81095 WP_001288302.1.81097 WP_001288302.1.81114 WP_001288302.1.81132 WP_001288302.1.81151 WP_001288302.1.81157 WP_001288302.1.81171 WP_001288302.1.81172 WP_001288302.1.81176 WP_001288302.1.81184 WP_001288302.1.81214 WP_001288302.1.81224 WP_001288302.1.81228 WP_001288302.1.81232 WP_001288302.1.81234 WP_001288302.1.81243 WP_001288302.1.8125 WP_001288302.1.81252 WP_001288302.1.81288 WP_001288302.1.81290 WP_001288302.1.81344 WP_001288302.1.8135 WP_001288302.1.81379 WP_001288302.1.81384 WP_001288302.1.81385 WP_001288302.1.81387 WP_001288302.1.81389 WP_001288302.1.8142 WP_001288302.1.8144 WP_001288302.1.81464 WP_001288302.1.81467 WP_001288302.1.81508 WP_001288302.1.81522 WP_001288302.1.81532 WP_001288302.1.81574 WP_001288302.1.81599 WP_001288302.1.8160 WP_001288302.1.81604 WP_001288302.1.81610 WP_001288302.1.81619 WP_001288302.1.81645 WP_001288302.1.81651 WP_001288302.1.81718 WP_001288302.1.81738 WP_001288302.1.81740 WP_001288302.1.81758 WP_001288302.1.81767 WP_001288302.1.81789 WP_001288302.1.8180 WP_001288302.1.81800 WP_001288302.1.81810 WP_001288302.1.81812 WP_001288302.1.81829 WP_001288302.1.81831 WP_001288302.1.81837 WP_001288302.1.81838 WP_001288302.1.81847 WP_001288302.1.8185 WP_001288302.1.81861 WP_001288302.1.81870 WP_001288302.1.81897 WP_001288302.1.81903 WP_001288302.1.81905 WP_001288302.1.81906 WP_001288302.1.81919 WP_001288302.1.81944 WP_001288302.1.81955 WP_001288302.1.81969 WP_001288302.1.81982 WP_001288302.1.81990 WP_001288302.1.81999 WP_001288302.1.82009 WP_001288302.1.82017 WP_001288302.1.82026 WP_001288302.1.82053 WP_001288302.1.82058 WP_001288302.1.8206 WP_001288302.1.82091 WP_001288302.1.82100 WP_001288302.1.82103 WP_001288302.1.8212 WP_001288302.1.82121 WP_001288302.1.8213 WP_001288302.1.82174 WP_001288302.1.82184 WP_001288302.1.82219 WP_001288302.1.82234 WP_001288302.1.82247 WP_001288302.1.82253 WP_001288302.1.82259 WP_001288302.1.82278 WP_001288302.1.82281 WP_001288302.1.82301 WP_001288302.1.82315 WP_001288302.1.82321 WP_001288302.1.82340 WP_001288302.1.82349 WP_001288302.1.82354 WP_001288302.1.82358 WP_001288302.1.82368 WP_001288302.1.82406 WP_001288302.1.82441 WP_001288302.1.82447 WP_001288302.1.82455 WP_001288302.1.82458 WP_001288302.1.8246 WP_001288302.1.82467 WP_001288302.1.82468 WP_001288302.1.82472 WP_001288302.1.82525 WP_001288302.1.82535 WP_001288302.1.82548 WP_001288302.1.82558 WP_001288302.1.8261 WP_001288302.1.82612 WP_001288302.1.8265 WP_001288302.1.8266 WP_001288302.1.82664 WP_001288302.1.82665 WP_001288302.1.82678 WP_001288302.1.82709 WP_001288302.1.82724 WP_001288302.1.82768 WP_001288302.1.82775 WP_001288302.1.82796 WP_001288302.1.8280 WP_001288302.1.82802 WP_001288302.1.82824 WP_001288302.1.82829 WP_001288302.1.82855 WP_001288302.1.82862 WP_001288302.1.8288 WP_001288302.1.8289 WP_001288302.1.82930 WP_001288302.1.82941 WP_001288302.1.82976 WP_001288302.1.82980 WP_001288302.1.82999 WP_001288302.1.8302 WP_001288302.1.83021 WP_001288302.1.83046 WP_001288302.1.83054 WP_001288302.1.83066 WP_001288302.1.83078 WP_001288302.1.83086 WP_001288302.1.83088 WP_001288302.1.8310 WP_001288302.1.83103 WP_001288302.1.83152 WP_001288302.1.83153 WP_001288302.1.8318 WP_001288302.1.83185 WP_001288302.1.8319 WP_001288302.1.83193 WP_001288302.1.83203 WP_001288302.1.83234 WP_001288302.1.83249 WP_001288302.1.83250 WP_001288302.1.8328 WP_001288302.1.83291 WP_001288302.1.83314 WP_001288302.1.83316 WP_001288302.1.83352 WP_001288302.1.83359 WP_001288302.1.83372 WP_001288302.1.83405 WP_001288302.1.83417 WP_001288302.1.83418 WP_001288302.1.8346 WP_001288302.1.83467 WP_001288302.1.83468 WP_001288302.1.83472 WP_001288302.1.83476 WP_001288302.1.83479 WP_001288302.1.83484 WP_001288302.1.83508 WP_001288302.1.83517 WP_001288302.1.83520 WP_001288302.1.83541 WP_001288302.1.83553 WP_001288302.1.83593 WP_001288302.1.83597 WP_001288302.1.83624 WP_001288302.1.83646 WP_001288302.1.83652 WP_001288302.1.83653 WP_001288302.1.8366 WP_001288302.1.83674 WP_001288302.1.83676 WP_001288302.1.83720 WP_001288302.1.83728 WP_001288302.1.83750 WP_001288302.1.83756 WP_001288302.1.83758 WP_001288302.1.83763 WP_001288302.1.83769 WP_001288302.1.83770 WP_001288302.1.83775 WP_001288302.1.83788 WP_001288302.1.83792 WP_001288302.1.83797 WP_001288302.1.83804 WP_001288302.1.83816 WP_001288302.1.83825 WP_001288302.1.8383 WP_001288302.1.83844 WP_001288302.1.83864 WP_001288302.1.83865 WP_001288302.1.83881 WP_001288302.1.83886 WP_001288302.1.83905 WP_001288302.1.83912 WP_001288302.1.83919 WP_001288302.1.83928 WP_001288302.1.83955 WP_001288302.1.83980 WP_001288302.1.83984 WP_001288302.1.83989 WP_001288302.1.84025 WP_001288302.1.84049 WP_001288302.1.84054 WP_001288302.1.84064 WP_001288302.1.84118 WP_001288302.1.84129 WP_001288302.1.84144 WP_001288302.1.84161 WP_001288302.1.84163 WP_001288302.1.84188 WP_001288302.1.84194 WP_001288302.1.84275 WP_001288302.1.84293 WP_001288302.1.8432 WP_001288302.1.84342 WP_001288302.1.84415 WP_001288302.1.84418 WP_001288302.1.84442 WP_001288302.1.84445 WP_001288302.1.84451 WP_001288302.1.84508 WP_001288302.1.84509 WP_001288302.1.84563 WP_001288302.1.84578 WP_001288302.1.84590 WP_001288302.1.84596 WP_001288302.1.84608 WP_001288302.1.8462 WP_001288302.1.84625 WP_001288302.1.84638 WP_001288302.1.84648 WP_001288302.1.84651 WP_001288302.1.84673 WP_001288302.1.84679 WP_001288302.1.8468 WP_001288302.1.84682 WP_001288302.1.84696 WP_001288302.1.84700 WP_001288302.1.84714 WP_001288302.1.84736 WP_001288302.1.8475 WP_001288302.1.84752 WP_001288302.1.84757 WP_001288302.1.84761 WP_001288302.1.84770 WP_001288302.1.84815 WP_001288302.1.84826 WP_001288302.1.84844 WP_001288302.1.84847 WP_001288302.1.84854 WP_001288302.1.84874 WP_001288302.1.84889 WP_001288302.1.84903 WP_001288302.1.84907 WP_001288302.1.84922 WP_001288302.1.84924 WP_001288302.1.8493 WP_001288302.1.84943 WP_001288302.1.84951 WP_001288302.1.8496 WP_001288302.1.84975 WP_001288302.1.84978 WP_001288302.1.85017 WP_001288302.1.85022 WP_001288302.1.85026 WP_001288302.1.85045 WP_001288302.1.85047 WP_001288302.1.85056 WP_001288302.1.85070 WP_001288302.1.85081 WP_001288302.1.85099 WP_001288302.1.85113 WP_001288302.1.85118 WP_001288302.1.85132 WP_001288302.1.85133 WP_001288302.1.85135 WP_001288302.1.85144 WP_001288302.1.85151 WP_001288302.1.85160 WP_001288302.1.85173 WP_001288302.1.85198 WP_001288302.1.85213 WP_001288302.1.85226 WP_001288302.1.85229 WP_001288302.1.85231 WP_001288302.1.85235 WP_001288302.1.85238 WP_001288302.1.85265 WP_001288302.1.85289 WP_001288302.1.85302 WP_001288302.1.85331 WP_001288302.1.85351 WP_001288302.1.85354 WP_001288302.1.85374 WP_001288302.1.85375 WP_001288302.1.85376 WP_001288302.1.85383 WP_001288302.1.85391 WP_001288302.1.85395 WP_001288302.1.85401 WP_001288302.1.85404 WP_001288302.1.85409 WP_001288302.1.85425 WP_001288302.1.85440 WP_001288302.1.85441 WP_001288302.1.85445 WP_001288302.1.85462 WP_001288302.1.85471 WP_001288302.1.85474 WP_001288302.1.85485 WP_001288302.1.85492 WP_001288302.1.85506 WP_001288302.1.8551 WP_001288302.1.85515 WP_001288302.1.85519 WP_001288302.1.85547 WP_001288302.1.85549 WP_001288302.1.85555 WP_001288302.1.85562 WP_001288302.1.85585 WP_001288302.1.85586 WP_001288302.1.85596 WP_001288302.1.85611 WP_001288302.1.85634 WP_001288302.1.85649 WP_001288302.1.8572 WP_001288302.1.85730 WP_001288302.1.85732 WP_001288302.1.85758 WP_001288302.1.8576 WP_001288302.1.85795 WP_001288302.1.85796 WP_001288302.1.85816 WP_001288302.1.85825 WP_001288302.1.85834 WP_001288302.1.85858 WP_001288302.1.85873 WP_001288302.1.85906 WP_001288302.1.85924 WP_001288302.1.85927 WP_001288302.1.85950 WP_001288302.1.85971 WP_001288302.1.85980 WP_001288302.1.85989 WP_001288302.1.85993 WP_001288302.1.86018 WP_001288302.1.86036 WP_001288302.1.86042 WP_001288302.1.86072 WP_001288302.1.86086 WP_001288302.1.8609 WP_001288302.1.86123 WP_001288302.1.86136 WP_001288302.1.86144 WP_001288302.1.86153 WP_001288302.1.86154 WP_001288302.1.86158 WP_001288302.1.8617 WP_001288302.1.86188 WP_001288302.1.86197 WP_001288302.1.862 WP_001288302.1.86207 WP_001288302.1.86209 WP_001288302.1.86241 WP_001288302.1.86248 WP_001288302.1.8627 WP_001288302.1.86270 WP_001288302.1.86281 WP_001288302.1.86304 WP_001288302.1.86315 WP_001288302.1.86331 WP_001288302.1.86344 WP_001288302.1.8636 WP_001288302.1.86363 WP_001288302.1.86367 WP_001288302.1.86378 WP_001288302.1.86390 WP_001288302.1.8641 WP_001288302.1.8643 WP_001288302.1.86439 WP_001288302.1.86455 WP_001288302.1.86473 WP_001288302.1.86482 WP_001288302.1.86508 WP_001288302.1.86523 WP_001288302.1.86526 WP_001288302.1.86531 WP_001288302.1.86542 WP_001288302.1.86606 WP_001288302.1.86628 WP_001288302.1.8663 WP_001288302.1.86664 WP_001288302.1.86704 WP_001288302.1.86706 WP_001288302.1.86745 WP_001288302.1.86779 WP_001288302.1.86792 WP_001288302.1.86793 WP_001288302.1.86795 WP_001288302.1.8681 WP_001288302.1.86838 WP_001288302.1.86881 WP_001288302.1.8690 WP_001288302.1.86910 WP_001288302.1.86911 WP_001288302.1.86916 WP_001288302.1.86940 WP_001288302.1.86942 WP_001288302.1.86961 WP_001288302.1.86968 WP_001288302.1.86977 WP_001288302.1.8699 WP_001288302.1.86999 WP_001288302.1.87021 WP_001288302.1.87042 WP_001288302.1.87057 WP_001288302.1.87072 WP_001288302.1.87088 WP_001288302.1.87090 WP_001288302.1.87096 WP_001288302.1.87097 WP_001288302.1.87100 WP_001288302.1.87110 WP_001288302.1.87119 WP_001288302.1.8712 WP_001288302.1.87122 WP_001288302.1.87133 WP_001288302.1.87137 WP_001288302.1.87141 WP_001288302.1.87168 WP_001288302.1.87175 WP_001288302.1.87190 WP_001288302.1.87194 WP_001288302.1.8720 WP_001288302.1.87204 WP_001288302.1.87221 WP_001288302.1.87236 WP_001288302.1.87260 WP_001288302.1.87261 WP_001288302.1.87264 WP_001288302.1.87272 WP_001288302.1.87285 WP_001288302.1.87290 WP_001288302.1.87296 WP_001288302.1.87363 WP_001288302.1.87372 WP_001288302.1.87388 WP_001288302.1.87396 WP_001288302.1.87457 WP_001288302.1.87461 WP_001288302.1.87466 WP_001288302.1.87486 WP_001288302.1.87497 WP_001288302.1.875 WP_001288302.1.87508 WP_001288302.1.87511 WP_001288302.1.87515 WP_001288302.1.8753 WP_001288302.1.87534 WP_001288302.1.87541 WP_001288302.1.87543 WP_001288302.1.8757 WP_001288302.1.87579 WP_001288302.1.87593 WP_001288302.1.87595 WP_001288302.1.87601 WP_001288302.1.87636 WP_001288302.1.8764 WP_001288302.1.87647 WP_001288302.1.87682 WP_001288302.1.8770 WP_001288302.1.87703 WP_001288302.1.87710 WP_001288302.1.87718 WP_001288302.1.87734 WP_001288302.1.87735 WP_001288302.1.87745 WP_001288302.1.87748 WP_001288302.1.87764 WP_001288302.1.87782 WP_001288302.1.8779 WP_001288302.1.87808 WP_001288302.1.87828 WP_001288302.1.87838 WP_001288302.1.87841 WP_001288302.1.87843 WP_001288302.1.87854 WP_001288302.1.87865 WP_001288302.1.87879 WP_001288302.1.8791 WP_001288302.1.87912 WP_001288302.1.87937 WP_001288302.1.87943 WP_001288302.1.87948 WP_001288302.1.87963 WP_001288302.1.87964 WP_001288302.1.87967 WP_001288302.1.87972 WP_001288302.1.87985 WP_001288302.1.87995 WP_001288302.1.88013 WP_001288302.1.88032 WP_001288302.1.88061 WP_001288302.1.88101 WP_001288302.1.88114 WP_001288302.1.88150 WP_001288302.1.88169 WP_001288302.1.88212 WP_001288302.1.88240 WP_001288302.1.88270 WP_001288302.1.88309 WP_001288302.1.88311 WP_001288302.1.88317 WP_001288302.1.88319 WP_001288302.1.88339 WP_001288302.1.88351 WP_001288302.1.88367 WP_001288302.1.88371 WP_001288302.1.88373 WP_001288302.1.88375 WP_001288302.1.88380 WP_001288302.1.88395 WP_001288302.1.88430 WP_001288302.1.88440 WP_001288302.1.88445 WP_001288302.1.88449 WP_001288302.1.88455 WP_001288302.1.8847 WP_001288302.1.88478 WP_001288302.1.88480 WP_001288302.1.88490 WP_001288302.1.88498 WP_001288302.1.88504 WP_001288302.1.88518 WP_001288302.1.88536 WP_001288302.1.88555 WP_001288302.1.88558 WP_001288302.1.88560 WP_001288302.1.88563 WP_001288302.1.8857 WP_001288302.1.88572 WP_001288302.1.88580 WP_001288302.1.88583 WP_001288302.1.88585 WP_001288302.1.8859 WP_001288302.1.88599 WP_001288302.1.88600 WP_001288302.1.88614 WP_001288302.1.88623 WP_001288302.1.88636 WP_001288302.1.88638 WP_001288302.1.88642 WP_001288302.1.88671 WP_001288302.1.88694 WP_001288302.1.88696 WP_001288302.1.8872 WP_001288302.1.88738 WP_001288302.1.88739 WP_001288302.1.88753 WP_001288302.1.88761 WP_001288302.1.8877 WP_001288302.1.88771 WP_001288302.1.88781 WP_001288302.1.88805 WP_001288302.1.88843 WP_001288302.1.88856 WP_001288302.1.88859 WP_001288302.1.8886 WP_001288302.1.88878 WP_001288302.1.8888 WP_001288302.1.88881 WP_001288302.1.88897 WP_001288302.1.88922 WP_001288302.1.88934 WP_001288302.1.88954 WP_001288302.1.88959 WP_001288302.1.88960 WP_001288302.1.88962 WP_001288302.1.88987 WP_001288302.1.8899 WP_001288302.1.8900 WP_001288302.1.89012 WP_001288302.1.89024 WP_001288302.1.89027 WP_001288302.1.89036 WP_001288302.1.8904 WP_001288302.1.89070 WP_001288302.1.89086 WP_001288302.1.89108 WP_001288302.1.89125 WP_001288302.1.8913 WP_001288302.1.89133 WP_001288302.1.89139 WP_001288302.1.89164 WP_001288302.1.8918 WP_001288302.1.89181 WP_001288302.1.89184 WP_001288302.1.89194 WP_001288302.1.89195 WP_001288302.1.89204 WP_001288302.1.89216 WP_001288302.1.89235 WP_001288302.1.8924 WP_001288302.1.89258 WP_001288302.1.89262 WP_001288302.1.89284 WP_001288302.1.8929 WP_001288302.1.89290 WP_001288302.1.89348 WP_001288302.1.89350 WP_001288302.1.89372 WP_001288302.1.89390 WP_001288302.1.89404 WP_001288302.1.89433 WP_001288302.1.89439 WP_001288302.1.89476 WP_001288302.1.8950 WP_001288302.1.89516 WP_001288302.1.89537 WP_001288302.1.89544 WP_001288302.1.89545 WP_001288302.1.89556 WP_001288302.1.89557 WP_001288302.1.89559 WP_001288302.1.89594 WP_001288302.1.89603 WP_001288302.1.89655 WP_001288302.1.89672 WP_001288302.1.89678 WP_001288302.1.89686 WP_001288302.1.897 WP_001288302.1.89715 WP_001288302.1.89726 WP_001288302.1.89730 WP_001288302.1.89738 WP_001288302.1.89754 WP_001288302.1.89779 WP_001288302.1.89794 WP_001288302.1.89799 WP_001288302.1.898 WP_001288302.1.89857 WP_001288302.1.8986 WP_001288302.1.89863 WP_001288302.1.89874 WP_001288302.1.89883 WP_001288302.1.8990 WP_001288302.1.89908 WP_001288302.1.89924 WP_001288302.1.89933 WP_001288302.1.89935 WP_001288302.1.89949 WP_001288302.1.89950 WP_001288302.1.89960 WP_001288302.1.90005 WP_001288302.1.90018 WP_001288302.1.90038 WP_001288302.1.90046 WP_001288302.1.90055 WP_001288302.1.90069 WP_001288302.1.90091 WP_001288302.1.90095 WP_001288302.1.90112 WP_001288302.1.90131 WP_001288302.1.90145 WP_001288302.1.90148 WP_001288302.1.90161 WP_001288302.1.90173 WP_001288302.1.90174 WP_001288302.1.90180 WP_001288302.1.90215 WP_001288302.1.90217 WP_001288302.1.9022 WP_001288302.1.90232 WP_001288302.1.90239 WP_001288302.1.90243 WP_001288302.1.90246 WP_001288302.1.90250 WP_001288302.1.90253 WP_001288302.1.90269 WP_001288302.1.90276 WP_001288302.1.9030 WP_001288302.1.90307 WP_001288302.1.90331 WP_001288302.1.90345 WP_001288302.1.90367 WP_001288302.1.90386 WP_001288302.1.90432 WP_001288302.1.90447 WP_001288302.1.90454 WP_001288302.1.90473 WP_001288302.1.90475 WP_001288302.1.90488 WP_001288302.1.90506 WP_001288302.1.90514 WP_001288302.1.90517 WP_001288302.1.90533 WP_001288302.1.90544 WP_001288302.1.9055 WP_001288302.1.90554 WP_001288302.1.90556 WP_001288302.1.90604 WP_001288302.1.90647 WP_001288302.1.90660 WP_001288302.1.90661 WP_001288302.1.90683 WP_001288302.1.90698 WP_001288302.1.9071 WP_001288302.1.90717 WP_001288302.1.90726 WP_001288302.1.90728 WP_001288302.1.90738 WP_001288302.1.90740 WP_001288302.1.90745 WP_001288302.1.90757 WP_001288302.1.9076 WP_001288302.1.90801 WP_001288302.1.90804 WP_001288302.1.90818 WP_001288302.1.90820 WP_001288302.1.90861 WP_001288302.1.90896 WP_001288302.1.90903 WP_001288302.1.90923 WP_001288302.1.90994 WP_001288302.1.9100 WP_001288302.1.91005 WP_001288302.1.91011 WP_001288302.1.91019 WP_001288302.1.91054 WP_001288302.1.91087 WP_001288302.1.91124 WP_001288302.1.91126 WP_001288302.1.9114 WP_001288302.1.91150 WP_001288302.1.91158 WP_001288302.1.91177 WP_001288302.1.91184 WP_001288302.1.912 WP_001288302.1.9122 WP_001288302.1.91233 WP_001288302.1.91246 WP_001288302.1.91252 WP_001288302.1.91258 WP_001288302.1.91279 WP_001288302.1.91280 WP_001288302.1.91287 WP_001288302.1.91297 WP_001288302.1.91300 WP_001288302.1.91310 WP_001288302.1.91332 WP_001288302.1.91346 WP_001288302.1.91357 WP_001288302.1.91364 WP_001288302.1.91365 WP_001288302.1.91371 WP_001288302.1.91382 WP_001288302.1.9140 WP_001288302.1.91420 WP_001288302.1.91427 WP_001288302.1.91447 WP_001288302.1.91486 WP_001288302.1.91487 WP_001288302.1.91500 WP_001288302.1.91525 WP_001288302.1.9153 WP_001288302.1.91530 WP_001288302.1.9155 WP_001288302.1.91559 WP_001288302.1.91573 WP_001288302.1.91581 WP_001288302.1.91586 WP_001288302.1.91587 WP_001288302.1.91611 WP_001288302.1.91624 WP_001288302.1.91629 WP_001288302.1.91634 WP_001288302.1.91639 WP_001288302.1.91660 WP_001288302.1.91670 WP_001288302.1.917 WP_001288302.1.91704 WP_001288302.1.91745 WP_001288302.1.91746 WP_001288302.1.91749 WP_001288302.1.91771 WP_001288302.1.91791 WP_001288302.1.91800 WP_001288302.1.91816 WP_001288302.1.91829 WP_001288302.1.91848 WP_001288302.1.91895 WP_001288302.1.91909 WP_001288302.1.91918 WP_001288302.1.91919 WP_001288302.1.91928 WP_001288302.1.91950 WP_001288302.1.91969 WP_001288302.1.92 WP_001288302.1.92055 WP_001288302.1.92080 WP_001288302.1.92115 WP_001288302.1.92125 WP_001288302.1.92140 WP_001288302.1.92143 WP_001288302.1.92147 WP_001288302.1.92164 WP_001288302.1.92169 WP_001288302.1.92173 WP_001288302.1.92185 WP_001288302.1.92186 WP_001288302.1.92196 WP_001288302.1.92212 WP_001288302.1.92227 WP_001288302.1.92228 WP_001288302.1.9224 WP_001288302.1.92244 WP_001288302.1.92249 WP_001288302.1.92253 WP_001288302.1.92254 WP_001288302.1.92259 WP_001288302.1.92297 WP_001288302.1.923 WP_001288302.1.92303 WP_001288302.1.9234 WP_001288302.1.92340 WP_001288302.1.9237 WP_001288302.1.9239 WP_001288302.1.92391 WP_001288302.1.92398 WP_001288302.1.92405 WP_001288302.1.92415 WP_001288302.1.92425 WP_001288302.1.92436 WP_001288302.1.92442 WP_001288302.1.9247 WP_001288302.1.92479 WP_001288302.1.92488 WP_001288302.1.92497 WP_001288302.1.92500 WP_001288302.1.92512 WP_001288302.1.92520 WP_001288302.1.92534 WP_001288302.1.92541 WP_001288302.1.92544 WP_001288302.1.92546 WP_001288302.1.92565 WP_001288302.1.92602 WP_001288302.1.92607 WP_001288302.1.92667 WP_001288302.1.92674 WP_001288302.1.92679 WP_001288302.1.92688 WP_001288302.1.92691 WP_001288302.1.92718 WP_001288302.1.92723 WP_001288302.1.92735 WP_001288302.1.92741 WP_001288302.1.92765 WP_001288302.1.92773 WP_001288302.1.92778 WP_001288302.1.92789 WP_001288302.1.92795 WP_001288302.1.92805 WP_001288302.1.92848 WP_001288302.1.9286 WP_001288302.1.92862 WP_001288302.1.92897 WP_001288302.1.92918 WP_001288302.1.9293 WP_001288302.1.92937 WP_001288302.1.92950 WP_001288302.1.9296 WP_001288302.1.92960 WP_001288302.1.92965 WP_001288302.1.9298 WP_001288302.1.92997 WP_001288302.1.93010 WP_001288302.1.93041 WP_001288302.1.93047 WP_001288302.1.9305 WP_001288302.1.93068 WP_001288302.1.93071 WP_001288302.1.93074 WP_001288302.1.93125 WP_001288302.1.93141 WP_001288302.1.93147 WP_001288302.1.93163 WP_001288302.1.93176 WP_001288302.1.93186 WP_001288302.1.93191 WP_001288302.1.93197 WP_001288302.1.93198 WP_001288302.1.93207 WP_001288302.1.93211 WP_001288302.1.93224 WP_001288302.1.93231 WP_001288302.1.93235 WP_001288302.1.93237 WP_001288302.1.93243 WP_001288302.1.93254 WP_001288302.1.93260 WP_001288302.1.93263 WP_001288302.1.93272 WP_001288302.1.93296 WP_001288302.1.9330 WP_001288302.1.93300 WP_001288302.1.93310 WP_001288302.1.93316 WP_001288302.1.93336 WP_001288302.1.93354 WP_001288302.1.93374 WP_001288302.1.93378 WP_001288302.1.93416 WP_001288302.1.93435 WP_001288302.1.93438 WP_001288302.1.93444 WP_001288302.1.93471 WP_001288302.1.93492 WP_001288302.1.93514 WP_001288302.1.9352 WP_001288302.1.93538 WP_001288302.1.9354 WP_001288302.1.93567 WP_001288302.1.93579 WP_001288302.1.9358 WP_001288302.1.93590 WP_001288302.1.93613 WP_001288302.1.93647 WP_001288302.1.93658 WP_001288302.1.93669 WP_001288302.1.93678 WP_001288302.1.93690 WP_001288302.1.93708 WP_001288302.1.93710 WP_001288302.1.93722 WP_001288302.1.93736 WP_001288302.1.93738 WP_001288302.1.93758 WP_001288302.1.93762 WP_001288302.1.93769 WP_001288302.1.93775 WP_001288302.1.93787 WP_001288302.1.9387 WP_001288302.1.93882 WP_001288302.1.93883 WP_001288302.1.93890 WP_001288302.1.93891 WP_001288302.1.9392 WP_001288302.1.93975 WP_001288302.1.93976 WP_001288302.1.9398 WP_001288302.1.93981 WP_001288302.1.94 WP_001288302.1.94053 WP_001288302.1.94074 WP_001288302.1.9408 WP_001288302.1.94080 WP_001288302.1.94082 WP_001288302.1.94087 WP_001288302.1.94093 WP_001288302.1.94096 WP_001288302.1.9411 WP_001288302.1.94119 WP_001288302.1.94122 WP_001288302.1.94123 WP_001288302.1.94130 WP_001288302.1.94165 WP_001288302.1.94172 WP_001288302.1.94182 WP_001288302.1.94209 WP_001288302.1.94229 WP_001288302.1.94242 WP_001288302.1.94248 WP_001288302.1.94268 WP_001288302.1.94287 WP_001288302.1.94293 WP_001288302.1.94294 WP_001288302.1.9430 WP_001288302.1.94319 WP_001288302.1.94320 WP_001288302.1.94324 WP_001288302.1.94325 WP_001288302.1.94335 WP_001288302.1.94337 WP_001288302.1.94340 WP_001288302.1.94341 WP_001288302.1.9437 WP_001288302.1.94374 WP_001288302.1.94375 WP_001288302.1.94376 WP_001288302.1.94389 WP_001288302.1.94407 WP_001288302.1.94414 WP_001288302.1.94423 WP_001288302.1.94484 WP_001288302.1.94505 WP_001288302.1.94530 WP_001288302.1.94536 WP_001288302.1.9455 WP_001288302.1.94550 WP_001288302.1.94576 WP_001288302.1.94625 WP_001288302.1.9464 WP_001288302.1.94684 WP_001288302.1.94688 WP_001288302.1.947 WP_001288302.1.94719 WP_001288302.1.94733 WP_001288302.1.94741 WP_001288302.1.94789 WP_001288302.1.94797 WP_001288302.1.94825 WP_001288302.1.94838 WP_001288302.1.94844 WP_001288302.1.94845 WP_001288302.1.9485 WP_001288302.1.94857 WP_001288302.1.94866 WP_001288302.1.94969 WP_001288302.1.9497 WP_001288302.1.94980 WP_001288302.1.94989 WP_001288302.1.94992 WP_001288302.1.94999 WP_001288302.1.95002 WP_001288302.1.95008 WP_001288302.1.95023 WP_001288302.1.95029 WP_001288302.1.95033 WP_001288302.1.95038 WP_001288302.1.95075 WP_001288302.1.95077 WP_001288302.1.9510 WP_001288302.1.95120 WP_001288302.1.95154 WP_001288302.1.95156 WP_001288302.1.95193 WP_001288302.1.95210 WP_001288302.1.95263 WP_001288302.1.95281 WP_001288302.1.95294 WP_001288302.1.95307 WP_001288302.1.95318 WP_001288302.1.95327 WP_001288302.1.95342 WP_001288302.1.95361 WP_001288302.1.95372 WP_001288302.1.9538 WP_001288302.1.95386 WP_001288302.1.95415 WP_001288302.1.9544 WP_001288302.1.95442 WP_001288302.1.95476 WP_001288302.1.95494 WP_001288302.1.95495 WP_001288302.1.95505 WP_001288302.1.95512 WP_001288302.1.95519 WP_001288302.1.95522 WP_001288302.1.95535 WP_001288302.1.95537 WP_001288302.1.95550 WP_001288302.1.95552 WP_001288302.1.95560 WP_001288302.1.9557 WP_001288302.1.95571 WP_001288302.1.95581 WP_001288302.1.95603 WP_001288302.1.9563 WP_001288302.1.95631 WP_001288302.1.95639 WP_001288302.1.95640 WP_001288302.1.95681 WP_001288302.1.95683 WP_001288302.1.95699 WP_001288302.1.95704 WP_001288302.1.95713 WP_001288302.1.95714 WP_001288302.1.95737 WP_001288302.1.95760 WP_001288302.1.95780 WP_001288302.1.95804 WP_001288302.1.95806 WP_001288302.1.95832 WP_001288302.1.95877 WP_001288302.1.95885 WP_001288302.1.959 WP_001288302.1.95914 WP_001288302.1.95918 WP_001288302.1.95962 WP_001288302.1.95986 WP_001288302.1.95997 WP_001288302.1.96014 WP_001288302.1.96022 WP_001288302.1.96030 WP_001288302.1.96056 WP_001288302.1.96057 WP_001288302.1.96067 WP_001288302.1.96075 WP_001288302.1.96105 WP_001288302.1.96135 WP_001288302.1.96148 WP_001288302.1.96160 WP_001288302.1.96163 WP_001288302.1.96165 WP_001288302.1.9617 WP_001288302.1.96200 WP_001288302.1.96209 WP_001288302.1.96218 WP_001288302.1.96228 WP_001288302.1.96255 WP_001288302.1.96261 WP_001288302.1.96271 WP_001288302.1.96280 WP_001288302.1.96283 WP_001288302.1.96297 WP_001288302.1.96305 WP_001288302.1.96312 WP_001288302.1.96314 WP_001288302.1.96316 WP_001288302.1.96322 WP_001288302.1.96334 WP_001288302.1.96362 WP_001288302.1.96364 WP_001288302.1.96368 WP_001288302.1.96412 WP_001288302.1.96424 WP_001288302.1.96433 WP_001288302.1.96468 WP_001288302.1.96472 WP_001288302.1.96474 WP_001288302.1.96477 WP_001288302.1.96489 WP_001288302.1.9650 WP_001288302.1.96535 WP_001288302.1.96538 WP_001288302.1.96548 WP_001288302.1.96554 WP_001288302.1.96566 WP_001288302.1.96568 WP_001288302.1.96577 WP_001288302.1.96578 WP_001288302.1.96591 WP_001288302.1.96603 WP_001288302.1.96613 WP_001288302.1.96628 WP_001288302.1.96634 WP_001288302.1.96637 WP_001288302.1.96638 WP_001288302.1.96646 WP_001288302.1.96654 WP_001288302.1.96663 WP_001288302.1.96678 WP_001288302.1.96682 WP_001288302.1.96688 WP_001288302.1.96699 WP_001288302.1.96705 WP_001288302.1.96718 WP_001288302.1.96727 WP_001288302.1.9675 WP_001288302.1.96770 WP_001288302.1.96780 WP_001288302.1.96804 WP_001288302.1.96836 WP_001288302.1.96854 WP_001288302.1.96855 WP_001288302.1.96859 WP_001288302.1.96866 WP_001288302.1.96882 WP_001288302.1.96892 WP_001288302.1.96895 WP_001288302.1.96918 WP_001288302.1.96922 WP_001288302.1.96928 WP_001288302.1.9695 WP_001288302.1.96956 WP_001288302.1.96965 WP_001288302.1.96969 WP_001288302.1.96970 WP_001288302.1.96976 WP_001288302.1.96985 WP_001288302.1.96997 WP_001288302.1.97000 WP_001288302.1.97001 WP_001288302.1.97004 WP_001288302.1.97007 WP_001288302.1.97014 WP_001288302.1.97019 WP_001288302.1.97029 WP_001288302.1.97033 WP_001288302.1.97034 WP_001288302.1.97072 WP_001288302.1.97077 WP_001288302.1.97117 WP_001288302.1.97138 WP_001288302.1.97139 WP_001288302.1.97141 WP_001288302.1.97146 WP_001288302.1.97161 WP_001288302.1.97164 WP_001288302.1.97191 WP_001288302.1.97205 WP_001288302.1.97228 WP_001288302.1.97230 WP_001288302.1.97234 WP_001288302.1.97241 WP_001288302.1.97267 WP_001288302.1.97293 WP_001288302.1.97295 WP_001288302.1.97302 WP_001288302.1.97311 WP_001288302.1.97312 WP_001288302.1.97336 WP_001288302.1.97348 WP_001288302.1.97352 WP_001288302.1.97355 WP_001288302.1.97367 WP_001288302.1.9737 WP_001288302.1.97392 WP_001288302.1.97409 WP_001288302.1.97411 WP_001288302.1.97427 WP_001288302.1.9743 WP_001288302.1.97444 WP_001288302.1.97450 WP_001288302.1.97456 WP_001288302.1.97460 WP_001288302.1.97466 WP_001288302.1.97468 WP_001288302.1.9748 WP_001288302.1.97484 WP_001288302.1.97494 WP_001288302.1.97530 WP_001288302.1.97531 WP_001288302.1.97536 WP_001288302.1.97537 WP_001288302.1.97574 WP_001288302.1.97575 WP_001288302.1.97576 WP_001288302.1.9758 WP_001288302.1.97585 WP_001288302.1.97590 WP_001288302.1.97627 WP_001288302.1.97641 WP_001288302.1.97664 WP_001288302.1.97696 WP_001288302.1.97699 WP_001288302.1.97717 WP_001288302.1.97720 WP_001288302.1.97729 WP_001288302.1.97731 WP_001288302.1.97739 WP_001288302.1.97742 WP_001288302.1.97744 WP_001288302.1.97746 WP_001288302.1.97758 WP_001288302.1.97762 WP_001288302.1.97763 WP_001288302.1.97786 WP_001288302.1.97827 WP_001288302.1.97835 WP_001288302.1.9788 WP_001288302.1.9789 WP_001288302.1.97899 WP_001288302.1.97935 WP_001288302.1.97953 WP_001288302.1.97955 WP_001288302.1.97967 WP_001288302.1.97974 WP_001288302.1.97997 WP_001288302.1.97999 WP_001288302.1.98011 WP_001288302.1.98033 WP_001288302.1.98051 WP_001288302.1.98054 WP_001288302.1.98058 WP_001288302.1.98073 WP_001288302.1.98131 WP_001288302.1.98161 WP_001288302.1.98174 WP_001288302.1.98179 WP_001288302.1.98191 WP_001288302.1.98195 WP_001288302.1.98233 WP_001288302.1.98242 WP_001288302.1.98248 WP_001288302.1.98249 WP_001288302.1.98281 WP_001288302.1.98295 WP_001288302.1.98307 WP_001288302.1.98322 WP_001288302.1.98328 WP_001288302.1.98352 WP_001288302.1.98353 WP_001288302.1.98360 WP_001288302.1.98361 WP_001288302.1.98366 WP_001288302.1.98379 WP_001288302.1.98387 WP_001288302.1.98409 WP_001288302.1.98411 WP_001288302.1.98415 WP_001288302.1.98419 WP_001288302.1.98425 WP_001288302.1.98456 WP_001288302.1.98497 WP_001288302.1.98510 WP_001288302.1.98512 WP_001288302.1.98548 WP_001288302.1.98552 WP_001288302.1.98559 WP_001288302.1.98585 WP_001288302.1.98609 WP_001288302.1.98655 WP_001288302.1.98659 WP_001288302.1.98667 WP_001288302.1.98706 WP_001288302.1.98710 WP_001288302.1.9872 WP_001288302.1.98723 WP_001288302.1.98730 WP_001288302.1.98734 WP_001288302.1.98741 WP_001288302.1.98750 WP_001288302.1.98767 WP_001288302.1.98786 WP_001288302.1.98797 WP_001288302.1.98805 WP_001288302.1.98807 WP_001288302.1.98821 WP_001288302.1.98837 WP_001288302.1.98858 WP_001288302.1.98874 WP_001288302.1.98880 WP_001288302.1.98883 WP_001288302.1.98894 WP_001288302.1.98912 WP_001288302.1.98967 WP_001288302.1.98978 WP_001288302.1.98981 WP_001288302.1.98985 WP_001288302.1.99009 WP_001288302.1.99025 WP_001288302.1.99027 WP_001288302.1.9903 WP_001288302.1.99081 WP_001288302.1.991 WP_001288302.1.9910 WP_001288302.1.9912 WP_001288302.1.99136 WP_001288302.1.99155 WP_001288302.1.99171 WP_001288302.1.99174 WP_001288302.1.99183 WP_001288302.1.99207 WP_001288302.1.99217 WP_001288302.1.99228 WP_001288302.1.99237 WP_001288302.1.99249 WP_001288302.1.99280 WP_001288302.1.99283 WP_001288302.1.99308 WP_001288302.1.99311 WP_001288302.1.99331 WP_001288302.1.99359 WP_001288302.1.9936 WP_001288302.1.99405 WP_001288302.1.99414 WP_001288302.1.99418 WP_001288302.1.99430 WP_001288302.1.99459 WP_001288302.1.99492 WP_001288302.1.99494 WP_001288302.1.99509 WP_001288302.1.99519 WP_001288302.1.99524 WP_001288302.1.99536 WP_001288302.1.99538 WP_001288302.1.99564 WP_001288302.1.99569 WP_001288302.1.9960 WP_001288302.1.99631 WP_001288302.1.99638 WP_001288302.1.9965 WP_001288302.1.99683 WP_001288302.1.99686 WP_001288302.1.99700 WP_001288302.1.99714 WP_001288302.1.9974 WP_001288302.1.99759 WP_001288302.1.99802 WP_001288302.1.99830 WP_001288302.1.99849 WP_001288302.1.99850 WP_001288302.1.99859 WP_001288302.1.99860 WP_001288302.1.99862 WP_001288302.1.9987 WP_001288302.1.99884 WP_001288302.1.99888 WP_001288302.1.99901 WP_001288302.1.99926 WP_001288302.1.99934 WP_001288302.1.99954 WP_001288302.1.99955 WP_001288302.1.99956 WP_001288302.1.99963 WP_001288302.1.99979 WP_001288302.1.99984 WP_001288302.1.99985 WP_001288302.1.99999 YP_499090.1.76163 gi|384546816|ref|YP_005736069.1| gi|379013818|ref|YP_005290054.1| gi|386728294|ref|YP_006194677.1| gi|384869121|ref|YP_005751835.1| gi|148266996|ref|YP_001245939.1| gi|387149697|ref|YP_005741261.1| gi|404477923|ref|YP_006709353.1| gi|151220710|ref|YP_001331532.1| IDP00612 gi|554643333|ref|YP_008715124.1| gi|269202159|ref|YP_003281428.1| gi|379020307|ref|YP_005296969.1| gi|384868539|ref|YP_005748735.1| gi|21282220|ref|NP_645308.1| gi|384549400|ref|YP_005738652.1| gi|150393043|ref|YP_001315718.1| gi|470198569|ref|YP_007584969.1| gi|384861198|ref|YP_005743918.1| gi|532358639|ref|YP_008448468.1| gi|87160422|ref|YP_493224.1| gi|49482766|ref|YP_039990.1| gi|15926213|ref|NP_373746.1| 158878.SAV0535 158879.SA0494 196620.MW0491 273036.SAB0487 282458.SAR0540 282459.SAS0494 359786.SaurJH9_0559 359787.SaurJH1_0573 418127.SAHV_0533 426430.NWMN_0498 451515.SAUSA300_0521 451516.USA300HOU_0530 681288.SAAV_0498 93061.SAOUHSC_00517 93062.SACOL0582 gi|470222162|ref|YP_007620719.1| gi|88194298|ref|YP_499090.1| gi|470194638|ref|YP_007580990.1| gi|387779676|ref|YP_005754474.1| gi|57651412|ref|YP_185468.1| gi|49485401|ref|YP_042622.1| gi|384863865|ref|YP_005749224.1| gi|545634019|ref|YP_008584589.1| gi|82750244|ref|YP_415985.1| gi|479328539|ref|YP_007867598.1| gi|470192673|ref|YP_007579026.1| gi|514065495|ref|YP_008127415.1| gi|470218339|ref|YP_007618733.1| gi|387142226|ref|YP_005730619.1| gi|156978864|ref|YP_001441123.1| gi|15923525|ref|NP_371059.1| gi|470224127|ref|YP_007622706.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]