SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|147548|fgenesh1_pg.32_#_30 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|147548|fgenesh1_pg.32_#_30
Domain Number 1 Region: 106-385
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.07e-65
Family RecA protein-like (ATPase-domain) 0.0000000824
Further Details:      
 
Domain Number 2 Region: 67-140
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.18e-20
Family Cold shock DNA-binding domain-like 0.00043
Further Details:      
 
Domain Number 3 Region: 24-64
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000000589
Family Rho termination factor, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|147548|fgenesh1_pg.32_#_30
Sequence length 443
Sequence
MGVNYMPERERTSPQYESFHELYKNYTTKELTQKAKTLKLTNYSKLNKKELVLAIMEAQM
EKDGNYYMEGILDDIQPDGYGFLRTVNYSKGEKDIYISASQIRRFEIKRGDKVTGKVRKP
KDNEKYYGLLQVDFVNDHNAEEVKKRPHFQALTPLYPDERIKLETETQNYSTRIMDLVTP
IGLGQRGLIVAPPKAGKTSLLKEIANAISTNKPDAKLFILLVGERPEEVTDLERSVEAAE
VVHSTFDEPPEHHVKVAELLLERAKRLVEIGEDVIILMDSITRLARAYNLVIPPSGRTLS
GGLDPASLHKPKAFFGAARNIEAGGSLTILATALVDTGSRMDDMIYEEFKGTGNMELHLD
RKLSERRIFPAIDIGRSSTRKEELLISKSELDTLWQLRNLFTDSTDFTERFIRKLKRSKN
NEDFFKQLQKSAEESTKTGRPII
Download sequence
Identical sequences A0A0E1VKB9 A0A0E1XA23 A0A133PU93 T1YC56
gi|470225233|ref|YP_007623812.1| gi|384866955|ref|YP_005747151.1| gi|537461836|ref|YP_008492276.1| gi|161510326|ref|YP_001575985.1| gi|470191812|ref|YP_007578122.1| gi|470193777|ref|YP_007580130.1| gi|470197708|ref|YP_007584109.1| 451516.USA300HOU_2109 gi|470219444|ref|YP_007619838.1| jgi|Aspzo1|147548|fgenesh1_pg.32_#_30 gi|470195743|ref|YP_007582095.1| gi|470223266|ref|YP_007621823.1| gi|521212888|ref|YP_008169234.1| gi|470199677|ref|YP_007586077.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]