SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|22445|estExt_Genemark1.C_2_t10195 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|22445|estExt_Genemark1.C_2_t10195
Domain Number 1 Region: 290-540,588-762
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.36e-19
Family Glycosyltransferase family 36 C-terminal domain 0.042
Further Details:      
 
Weak hits

Sequence:  jgi|Aspzo1|22445|estExt_Genemark1.C_2_t10195
Domain Number - Region: 64-106
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0353
Family Glutamine synthetase, N-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|22445|estExt_Genemark1.C_2_t10195
Sequence length 800
Sequence
MMLFRRLLWTAAVARGVFAAENSSVYDYDVLQYVDPLIGSSNGGNVFAGASVPYGMAKAV
ADTDSENNQGGFAFDGSKITGFSNMHDSGTGGSPSLGNFALFPYTKCNNDDLDGCVYPKK
ARKIGYDSNSVKATPGYFGLAMNSGVQVDMTASHHTSLFRFRFPTDNASSPLILLDLTDL
SDSRQDNASVSVNATTGRMIGNARFLPSFGSGSYNLYFCADFRSSAKVRDSGIFVDSRAS
NEVQDLKISRSINGYPLPGGGFIRFHSPPDNTILARVGVSFISSEQACSSAESEIPGFDF
NSTHSTAVKLWTEKLAPIRVSREGVNSSMLTNFYSGIYRTMISPQDYTGENPLWNSTEPY
FDSFYCLWDSFRSQFPFLTIFDPSSVARMIRSLIDTQRHLGWLPDCRMSLCKGFTQGGSN
ADNILADAYLKGLSDGIDWDAGYRAVQKDSEEEPYDWSNEGRGGLVSWKKLNYIPVQDFD
YQGFGTMTRSISRTLEYSYNEFVISQMALGLNKTSDFEKYRNRSGYWQNLWKADQTSFLN
AVNTGFTGFFQPKYLNGTWGFQDPLMCSNIDNSGSICSLQNTAGETFESSIWEYQFFVPH
DMTTLITLLGGPSQFVKRLDYLHDNNITYIGNEPAFLTVFQYHYAGRPAKSAQRSHFYIP
RFFQTTPDGLPGNDDSGAMGSFVAMSMMGLFPNPGQNVYLIMPPFFESISITSPLTGRTA
TVRTENFDPTYQNISIQSATLNGEPYHKNWIDHDFFTEGKELVLVLGPNESQWGTNNEDL
PPSVSSKAARSAELKGPGLS
Download sequence
Identical sequences A0A1L9SRG3
jgi|Aspzo1|22445|estExt_Genemark1.C_2_t10195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]