SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|1120025|CE949566_9057 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|1120025|CE949566_9057
Domain Number 1 Region: 26-503
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.48e-81
Family Pyridoxal-dependent decarboxylase 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|1120025|CE949566_9057
Sequence length 507
Sequence
MELTERQTTAHEIHRLQESLWTTAFSEWQSGVLPTPECLAKARQSLPASLPEEGTGFQSI
QKHILNDIVPAFNGGSISPNYYGFVTGGATPAALFADHVVSTYDQNVQVHIPSHSIVTDV
EFNALGLLADLLRLERTIWQNGTFTTGGTASNILGLALGREFVLKAAAERKGVSISSVGE
SGLFETIQAAGLTGVQVLTTLPHSSLGKAAGVLGIGRANVRAIPRDKNCLLFDYDQLEKE
LAQADKATIVAVSCGEVNTGQFATRGSEELRRLRALCDRYGAWMHVDGAFGIFGRVLDDS
AEFAAIRQGCEGIELADSIAGDGHKLLNVPYDCGFFLCRHPEIASNVFQNANAAYLTSSS
AQDHGPSIPSPLNIGLENSRRFRALPAYASLLSYGKHGYRNMLQRQIRLARLVAGWLFHH
PDYVALPEAPSEEELVQQVYMVVLFRAKDQTLNRDLAGKINATSKMFVSGTVWDGQPACR
IAISNWRVDEKRDFEIIKSVLEDVAGL
Download sequence
Identical sequences A0A1L9SSI2
jgi|Aspzo1|1120025|CE949566_9057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]