SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|135504|fgenesh1_kg.15_#_191_#_Locus2433v1rpkm88.63 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|135504|fgenesh1_kg.15_#_191_#_Locus2433v1rpkm88.63
Domain Number 1 Region: 116-523
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.85e-105
Family Pyridoxal-dependent decarboxylase 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|135504|fgenesh1_kg.15_#_191_#_Locus2433v1rpkm88.63
Sequence length 574
Sequence
MRTPSSMLPVALQSKLLGYTRAPHASLAVLNLDLIRNLVFFFFILRYVRKTFYFLRGYGL
FGGIRHLYAAVRLFCYSVFLRAPGIRGQLNKQVSTAIEKLETRLVVSGPDVTRHLVLPKE
GWTPEQIQAELDKLAGLEHTRWEDGRVSGAVYHGGQDLLKLQTEAFQRFGVANPIHPDVF
PGVRKMEAEVVAMVLALFNGSSEGAGVTTSGGTESILMACLAARQKAFHERGVTEPEMII
PDTAHAAFIKACSYFGIKLHRVPCPAPSYTVHVPSVRRLINPNTVLLVGSAPNFPHGMVD
DIPALSRLATKYKIPLHVDCCLGSFVIAFLKKAGFPSPYEEQGGFDFRQHGVTSISVDTH
KYGFAPKGNSVLLYRNRTYRSHQYFIYPDWSGGVYASPSIAGSRPGALIAGCWTSLMTVG
EAGYIKSCLEIVGAAKKFEASLNEHPVLSKHLQVIGKPMVSVVAFQSKNGAIDTYDIADD
LTEKGWHLNALQSPPALHMAFTIPTAAAVDKLTSDVVEVVEKELEKAEERKKQGKSYILK
RGDTSALYGVAGSLPDKSVVSRLAEGFLDTLYKA
Download sequence
Identical sequences A0A1L9SA59
jgi|Aspzo1|135504|fgenesh1_kg.15_#_191_#_Locus2433v1rpkm88.63

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]