SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|139170|fgenesh1_pg.2_#_279 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|139170|fgenesh1_pg.2_#_279
Domain Number 1 Region: 197-613
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.13e-97
Family GABA-aminotransferase-like 0.00000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|139170|fgenesh1_pg.2_#_279
Sequence length 675
Sequence
MPRRSSNSSTTDSSPSPTSLPTASGKGGIAFKAPSIKSNRLSQLFSTSPRSKSGFQTAQL
PAVGSNTPPTSAPPISSASLSLPTISLSTATSENSNMDEPPTTLFQPPSPEEARRLAKQH
AQFGPIGHPSHRYSSRHPGGPFPEPVMDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFR
EENYRHLKARNGYGALNSDFDNFYVRRLKLRINDCFERPVTGVPGRYITLIDRATDDHNK
HFHLTGTTTDTLNLSSYNYLGFAQSEGPCADLVEDTIKKYGISAVSTRSEVGTQDLHIEV
EDLIARFVGKEASMVFSMGFGTNATIFPALVGKGDLIISDELNHASIRFGARLSGASIGM
FKHNDMKDLEMRLREAISQGQPRTHRPWKKILVVVEGLYSMEGSMCNLPGLIALKRRYKF
HLFVDEAHSIGAIGPQGRGVCDYFGVDTAEVDILMGTLTKSFGANGGYIAADKAMIDKLR
ATNSGVFYGETIAPAVLAQISTALRIINGELIPGQGEERLQRLAFNSRYLRLGLKRLGFI
VYGHDDSPIIPLLLFNPAKMPAFSHEMLRRKISVVVVGYPATPLVSSRARFCVSAAHTKE
DLDRVLTACDEIGNVLQLKFSTGIAGGAVPSDDMVPPPEKEIEWRRQQAAKITPPRWRLE
DVIKRGTQDAKIPLC
Download sequence
Identical sequences A0A1L9SRH5
jgi|Aspzo1|139170|fgenesh1_pg.2_#_279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]