SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|143246|fgenesh1_pg.9_#_305 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|143246|fgenesh1_pg.9_#_305
Domain Number 1 Region: 1-249
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 7.59e-81
Family DR1281-like 0.019
Further Details:      
 
Domain Number 2 Region: 829-1099
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.75e-76
Family PFOR PP module 0.015
Further Details:      
 
Domain Number 3 Region: 465-725
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.98e-70
Family Pyruvate oxidase and decarboxylase Pyr module 0.068
Further Details:      
 
Domain Number 4 Region: 270-487
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.89e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0057
Further Details:      
 
Domain Number 5 Region: 738-815
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.08e-19
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|143246|fgenesh1_pg.9_#_305
Sequence length 1106
Sequence
MRIMFIGDIVGKIGRDAIETYIPQLKQKYKPTVTIVNAENAAHGKGLTEKIYKQLLRNGV
DFMTMGNHTYGQREIYDFIDEAKRLVRPANFPDEAPGIGMRFIQINDIKLAVINLQGRAF
MPDIDDPFKKADQLVKEAQEQTPFIFVDFHAETTSEKYAMGWHLDGRASAVVGTHTHIQT
ADERILPKGTGYITDVGMTGFYDGILGINKTEVIERFITSLPQRHVVPNEGRSVLSGVVI
DLDKEVNRWFFLLSFNMKYIHRRHITMKPQLSWKVGGQQGEGIESTGEIFATAMNRKGYY
LYGYRHFSSRIKGGHTNNKIRVSTTPVHAISDDLDILIAFDQETIEVNHHEMREDSIILA
DAKAKPVKPEGCHAQLIELPFTATAKELGTALMKNMVAIGATSALMNLNTNTFEELITNM
FSKKGDKVVEVNIQALNEGYQLMQSRLPEIDGDFELESTDALPHLYMIGNDAIGLGAIAA
GSQFMAAYPITPASEVMEYMIANISKVNGAVIQTEDEIAAVTMAIGANYGGVRAFTASAG
PGLSLMMEAIGLSGMTETPLVIINTQRGGPSTGLPTKQEQSDLMQMIYGTHGDIPKIVVA
PTDAEDAFYLTMEAFNLAEQYQCPVIVLSDLQLSLGKQTVEKLDYNRIEIKRGEIIQSDI
EREEDDKGYFKRYALTSNGVSPRPIPGVKGGIHHITGVEHNEEGKPSESASNRQQQMEKR
MRKIEQLLIESPVEANLQHEDADILYIGFISTKGAIQEGSNRLNQQGIKVNTIQIRQLHP
FPTSVIQDAVNKAKKVVVVEHNYQGQLASIIKMNVNIHDKIENYTKNNVKPNWCPGCGDF
SVQAAIQKAAANIGLEPEEVAIITGIGCSGRLSGYINSYGVHSIHGRALPLAQGVKMANK
DLTVIASGGDGDGYAIGMGHTIHALRRNMNMTYIVMDNQIYGLTKGQTSPSSAVGFVTKT
TPKGNIEKNVAPLELALSSGATFVAQGFSSDIKGLTKLIEDAINHDGFSFVNVFSPCVTY
NKINTYDWFKEHLTSVDDIENYDSTDKQLATRTVIEHESLVTGIVYQDKETPSYESQIKE
LDDTPLAKRDIKITEDTFNALTEQFI
Download sequence
Identical sequences jgi|Aspzo1|143246|fgenesh1_pg.9_#_305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]