SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|143366|fgenesh1_pg.9_#_425 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|143366|fgenesh1_pg.9_#_425
Domain Number 1 Region: 246-428
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.96e-22
Family Pyruvate oxidase and decarboxylase PP module 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Aspzo1|143366|fgenesh1_pg.9_#_425
Domain Number - Region: 43-230
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00101
Family Pyruvate oxidase and decarboxylase, middle domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|143366|fgenesh1_pg.9_#_425
Sequence length 432
Sequence
MFNNYVSYEFDMPIADDSKETIDAIYYQMQIASQYLYGPHKGPIHFNLPFRDPLTPDLNA
TELLTSEMKILPHYQKSIDASALRLILNKKKGLIIVGDMQHQEVDQILTYSTIYDLPILA
DPLSHLRKFDHPNVICTYDLLFRSGLDLKVDFVIRVGKPVISKKLNQWLKKTDAFQILVQ
NNDKIDVFPIAPDISYEISANDFFRSLMEDTTVNRVNWLEKWQRLEKKGRKEIKCYLEQA
TDESAFVGELIKKTSEKDALFISNSMPIRDVDNLLLNKNIDVYANRGANGIDGIVSTALG
MAVHKRVTLLIGDLSFYHDMNGLLMSKLNNIQMNIVLLNNDGGGIFSYLPQKESATDYFE
RLFGTPTGLDFEYTAKLYQFDFKRFNSVSEFKNATLLSETSTIYELITNREDNYEQHQIL
YQKLSEMIHDTL
Download sequence
Identical sequences jgi|Aspzo1|143366|fgenesh1_pg.9_#_425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]