SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspzo1|147985|fgenesh1_pm.1_#_36 from Aspergillus zonatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspzo1|147985|fgenesh1_pm.1_#_36
Domain Number 1 Region: 45-515
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.77e-171
Family GABA-aminotransferase-like 0.000000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspzo1|147985|fgenesh1_pm.1_#_36
Sequence length 518
Sequence
MSLNRCARHVSRLTPATSSRAAITARSWAQLRHVSSSSDEHHGVLSASLKEADPTVYQIV
QKEKKRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGARYYGGNQFIDEAERLCQ
QRALETFRLNPEEWGVNVQPLSGSPANLYAYSALLNTHDRLMGLDLPHGGHLSHGYQTPS
KKISFISKYFETMPYRLDESTGLIDYDALEKSAALFRPKLIVAGTSAYSRLIDYARMRKI
ADSVGAYLLSDMAHISGLVAADVIPSPFPFSDVVTTTTHKSLRGPRGAMIFYRKGVRRTD
KKGVPEMYDLEQPINASVFPGHQGGPHNHTITALAVALGQAQSKQFRTYQQTVLANAQAL
ADRLGQPSNNGGLGYNIVSGGTDNHLVLVDLKNRGVDGARVERVLELCGVASNKNTVPGD
RSALKPGGLRLGTPAMTSRGFQPDDFRRVADIVDHAVIVTQKLDKAAREAAAANGVKNPA
TLRAFLDYLGEGEEVSDIVMLRQEVEDWVGTFSLPWQE
Download sequence
Identical sequences A0A1L9STM9
jgi|Aspzo1|147985|fgenesh1_pm.1_#_36

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]