SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|404213094|ref|YP_006667269.1| from Gordonia sp. KTR9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404213094|ref|YP_006667269.1|
Domain Number 1 Region: 55-252
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 5.24e-24
Family Ava3068-like 0.087
Further Details:      
 
Weak hits

Sequence:  gi|404213094|ref|YP_006667269.1|
Domain Number - Region: 2-31
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00143
Family Rubredoxin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|404213094|ref|YP_006667269.1|
Sequence length 278
Comment beta-lactamase domain protein [Gordonia sp. KTR9]
Sequence
MRPWMCVFCANEFPPGETPPAMCPICDDDRQWLPVSGPSWTPLDETAGNALTADDVEPGL
TALSVRPSVGIGQRALLVTTSEGNILWEPPGFLGPSLVDWLDAHGGVAAIAASHPHLVGA
SVSLSHRFGRVPVYYNDFDRRWVTRPDPVVRFWSDSVEVLGGVRLVQCGGHFPGSAVLHV
PDAAGGRGALLTGDTIKGVMQPGMVTFMRSYPNMIPLSPRLVRGIADRVGGLRFDRLYDA
FGVVVEKGAREVVETSAARYSGWVTDGIVDPDDPHAPA
Download sequence
Identical sequences J9S9T5
WP_014925181.1.60447 gi|404213094|ref|YP_006667269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]