SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|404214928|ref|YP_006669123.1| from Gordonia sp. KTR9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404214928|ref|YP_006669123.1|
Domain Number 1 Region: 81-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000128
Family NfeD domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|404214928|ref|YP_006669123.1|
Sequence length 142
Comment putative membrane protein [Gordonia sp. KTR9]
Sequence
MSALLWLAAAIVLTVAEMFGGELVLLMLAGGALAAAGVDFVFEPPLWVDGLVFALVSVLL
LVAIRPVARRHMLNRPAVLMNTEALEGRPAVVTEQVDATDGRVKIDGDVWSARAMDPSQV
LEPGTHVTVVQIDGATAVVFRA
Download sequence
Identical sequences J9RKT0 R7YFC8
WP_010841048.1.38787 WP_010841048.1.50752 WP_010841048.1.60447 gi|404214928|ref|YP_006669123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]