SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357387421|ref|YP_004902260.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357387421|ref|YP_004902260.1|
Domain Number 1 Region: 28-287
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.46e-58
Family Protein kinases, catalytic subunit 0.0000496
Further Details:      
 
Weak hits

Sequence:  gi|357387421|ref|YP_004902260.1|
Domain Number - Region: 502-583
Classification Level Classification E-value
Superfamily PKD domain 0.000105
Family PKD domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|357387421|ref|YP_004902260.1|
Sequence length 595
Comment putative serine/threonine protein kinase [Kitasatospora setae KM-6054]
Sequence
MTTHGGTGGSGFDLAGSGAEPLAAEDPRAIGPVPLLGRLGAGGMGRVYLGVVGDRYAAVK
QVLPQFVEDPDYRRHFGHELDNLARLPEEATAPLLAADREARPPWLATAYVPGLTLDRVL
AVHGGPLDTARVWLLLRETAASLRAVHALDMIHRDLKPSNVMLTARGATLIDFGIARAAD
QSRLTRTGMVLGTPAYMAPEQANGDREFTSAVDVFALGALLAYAATGRPPFGEGSGVDML
YRVIHTEPDLDALRELSPVLAETVAACLDKNPAGRPSADRLVRLAAQHGPAPAERAGWPE
PVLGTLLARSAFAEQPAPAADPAADGAAEPLPPDGAPTKVLRVTGPPPEPGRRWHRRLVP
FVVPVLLVAGGTAAVQLLPFGGPPQQSQGQGQGQGQGQDASSPGLAGTPGGTPGGGAASG
PTPAADPDRSPNQDQGPTPSTPPTDSPAQSSADPDRKSTPSAPKSTAPAAKPTTPPANPA
NPVNPATPAKSSAPARAYGPRCVFTTAASCTSDDPTVELTSSGGWTDCTFTFTTDWGDGN
TTYTDTNGTGSADVRKTYATHRYAAPGTYRINVRAVTDSGFCLATGASLTFTLTP
Download sequence
Identical sequences E4N523
gi|357387421|ref|YP_004902260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]