SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357389127|ref|YP_004903966.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357389127|ref|YP_004903966.1|
Domain Number 1 Region: 29-306
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.08e-61
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357389127|ref|YP_004903966.1|
Sequence length 552
Comment putative menaquinol-cytochrome c reductase cytochrome b subunit [Kitasatospora setae KM-6054]
Sequence
MSSASGTNSASKPASTRAKPANKAEAAVDWVDGRVGIYSLAKANLRKIFPDHWSFMLGEI
CLYSFIIIILTGVYLTLFFTPSMGETVYHGSYLPLNGIRMSEAYASTLNISFEIRGGLLI
RQIHHWAALVFVAAMLVHMMRVFFTGAFRKPREINWVFGFLLLVLGMFDGFFGYSLPDDL
LSGTGIRFMEGAILAVPLVGTYIQMFLFGGEFPGHDIIPRFFTIHVLLIPGIMLGLLVAH
LILVFYHKHTQWAGPGKTEKNVVGMPLMPVYMAKAGGFFFLVFGIIAAISAIATINPIWS
VGPYRPDQVSTDAQPDWYMGFSEGLIRIMPGWEISVWGGHTLNLGVMVPLAVFPLVLVAI
AIWPFIESWVTGDKREHHILDRPRNAPVRTAFGAAWISLYLILLVGGGNDLFATHLHLSI
NTITYAVRVGFFVVPVLTFIVTKRWCLGLQRRDKDKVLHGRESGIIKRLPHGEFIEVHTP
LAQKDLHTLTAHEQPQPLELPAETDENGVARKAGVITKTRVKLSEGFYGEGNQIAKPTTE
EYHEITSGHGHH
Download sequence
Identical sequences E4N9X9
gi|357389127|ref|YP_004903966.1| WP_014135328.1.24815 WP_014135328.1.28511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]