SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357389740|ref|YP_004904580.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357389740|ref|YP_004904580.1|
Domain Number 1 Region: 82-398,512-543
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.64e-77
Family Type II chitinase 0.0000192
Further Details:      
 
Domain Number 2 Region: 398-510
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000000000011
Family Chitinase insertion domain 0.0069
Further Details:      
 
Domain Number 3 Region: 783-834
Classification Level Classification E-value
Superfamily Carbohydrate binding domain 0.000000000118
Family Carbohydrate binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357389740|ref|YP_004904580.1|
Sequence length 834
Comment chitinase [Kitasatospora setae KM-6054]
Sequence
MLIRNKAEQRPTAAGRHYKGRKVAFAATAAAGLAGLLMGTLGVAPSAAAVDNQACRPDGM
YTTPGVDVPYCNVYDTSGREQMGADHQRRVIGYFTSWRTGKDGTPAYLVNNIPWDKVTHL
NYAFAHVASDNTLSVGTDGPNNASTGMTFPGVAGAEMDPAYSYKGHFNLLSKFKKQYPNV
KTMVSVGGWAETGGYFDDSGSRVNSGGFYSMTVNADGSVNQAGINTFADSAVTFIKKYGF
NGVDLDYEYPTSMKDAGNPLDYTLSNAKRASLMKGYAALMKTMREKLDRASAADGKYYLL
SVAAPSSGYLLRGMETFQVTQYLDYVNIMSYDLHGAWNKYVGPNASLYDDGKDAELAAAN
VYGTSQYGGIGYLNTDWAVHYFRGAMPAGRINLGVPYYTRGFQNVQGGTNGLWGTSSTTN
CPAGSGLTTCGDGAVGIDNIWHDLDTNGKESPAGSNPMWHAKNLEAGVVPDYLSKYGVTD
TALKGTYTRNYSSALVAPWLWNADKKVFLSTEDDQSIGAKADYVVNQGVGGAMIWELAGD
YKWDATANGGKGEYVQGNTMTSLLYDKFKSASAYGATRSTIALPQQTLPIDVSFTDFALG
DNNYPINPKIHIVNNSTTTLPGGTEFQFDYSVSAPSNAADQSGFGSKVIRADHTGSNVGG
LKGTYNRVSLKLPTWQTLAPGASVDVAFVYYLPVSTPSNWTVNVAGTLYGITGDYTRGTT
ASTSSPSPSASVSASASASQSASPSASASASASASQSASPSASASASQSASPSASASVTA
GTCSGAPSWSAGTTYAAVTKVSWKGHYYQNKWWTAGEDPSLSGAWGVWTDLGAC
Download sequence
Identical sequences E4NBP3
gi|357389740|ref|YP_004904580.1| WP_014135937.1.24815 WP_014135937.1.28511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]