SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357389741|ref|YP_004904581.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357389741|ref|YP_004904581.1|
Domain Number 1 Region: 335-661,733-774
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.77e-80
Family Type II chitinase 0.0000000695
Further Details:      
 
Domain Number 2 Region: 243-335
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000103
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 3 Region: 55-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000128
Family CBM4/9 0.089
Further Details:      
 
Domain Number 4 Region: 663-733
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.00000578
Family Chitinase insertion domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357389741|ref|YP_004904581.1|
Sequence length 778
Comment chitinase [Kitasatospora setae KM-6054]
Sequence
MPERATAARSADRSAARPGRRPLKAGTALATATALVAGAAGLVTMISGASSAATVNLLAN
GDFESGTLTGWNCSAGLGSITSTAPHGGTKALQAAASASDTAQCSQAVAVSPNTTYSLSG
WLKGNYTYLGVTGTGTTDTNSWGSSADWANRSTTFTTGAATTSVTVYTHGWYGQGTYYAD
DLVLTGPGGSGSGSPSASASASTSASPSTSASTSPSASASASQSASPSASASQSGTPGGD
GVVTTPTGLTASVSGTSVTLKWNASTDNAQNGNSAVYRIFTGGTTNQTATSMGTAVTVSS
LLPNTSYSFTVQGYDKDGHSSGFTAPVTVTTGAAPTGAVKSAYFAQWGIYGNKYYPSTMA
ATGAASGLNTMTYAFANINPSTLSCFETIKAADTNDNNPNAGDGAGDAFADYQKGYTADI
AVDGTTDAWTQPLKGNFNQLRELKAKYPNLKVTMSLGGWTYSKYFSDAAATDASRKKLVS
SCIDMFIKGNLPSIQGDATGGTAAAMGIFDGIDIDWEYPASAGGHTGNHYAAADTANFTA
LLAEFRNQLDAYGQTVGKKYLLTAALPSGQDKIALLQTDQIGKYLDYGNVMSYDMHGAWD
ATGPTNLQDPLYDSPNDPSNPVAPGTQKYTVDNAVNAYLNGAPAYGIKGGFPAKKLVLGV
PFYFRGWTGVPAGSNYGLYQTATGPAAAQGTSQTAGVAFWKELAAAGKTTGSSVHWDPTT
QSSWIYDGTNLWTGDTPQAIAARGSYATAKGLGGVFAYSLEADDPSGTLVNAMTGSVK
Download sequence
Identical sequences E4NBP4
gi|357389741|ref|YP_004904581.1| WP_014135938.1.24815 WP_014135938.1.28511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]