SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357390373|ref|YP_004905213.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|357390373|ref|YP_004905213.1|
Domain Number - Region: 43-160
Classification Level Classification E-value
Superfamily DR1885-like metal-binding protein 0.000811
Family DR1885-like metal-binding protein 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|357390373|ref|YP_004905213.1|
Sequence length 224
Comment hypothetical protein KSE_34500 [Kitasatospora setae KM-6054]
Sequence
MSRSLRRGAAAAIVLAAIVPLAACAAGNDASTLEIKPDNAATSIAGKVKLNNIVVVTPAG
TAGEYKGAAAVTVNIANTGTSDEVLTSVKIGDTAAKLTGADGAAVTSIQIKAGQSVLLGG
TGNPTAQIASSDLSVGGYATTTFGFQQAGEVSADANVQPAVGHYAGFGPKAAASPSAAAS
GSAAASAGASAGASATASAPAGATASGSASAPVSPSGSASASAR
Download sequence
Identical sequences E4NDH6
WP_014136564.1.24815 WP_014136564.1.28511 gi|357390373|ref|YP_004905213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]