SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357390851|ref|YP_004905692.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357390851|ref|YP_004905692.1|
Domain Number 1 Region: 7-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-77
Family Protein kinases, catalytic subunit 0.0000000414
Further Details:      
 
Weak hits

Sequence:  gi|357390851|ref|YP_004905692.1|
Domain Number - Region: 480-516
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0366
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357390851|ref|YP_004905692.1|
Sequence length 684
Comment putative serine/threonine protein kinase [Kitasatospora setae KM-6054]
Sequence
MEEPRRLGGRYELGGVLGRGGMAEVYLGHDTRLGRTVAVKTLRTDMARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYIDGISIPYIVMEYVEGSTLRELLHTGRRLLPERALEMTI
GILQALEYSHRAGIVHRDIKPANVMLTRQGNVKVMDFGIARAMGDAGMTMTQTSAVIGTA
QYLSPEQAKGETVDARSDLYSTGCLLYELLTVRPPFVGDSPVAVAYQHVREEPAPPSSYD
PEVRPEIDAIVLKALAKERDYRYQSADEMRDDIERFLDGLPVNAAQQAAYGMGAAGYGYD
QGGNQYDPYGQTNVLPQQGGGPTTMLPQAGNQQPAPYGGYQDNGYNGGGGDGYDNGYEGR
SGRRREEPSKKNNTSWIVLAVAAVLVLVGAFFVVQSMMKTNKGAGKTSVPSLSGLSLADA
TSAAKAQSPNLKVQAGDPAASCPDTKVQKDQVCTQSPAAGGQMDDNGTIVVHLAAAAAQV
DVPDVAGQGKDAASKALKDKGFDVKVTYANDDKVEQDKVVSQDVKGKAAPGATVTLTVSS
GQQKIAVQSMVGKSQDVATQTLSDAGLTVTVTTKQVTDSSQIGQVVDQSPKTGQVKQGTP
VTIVVGKQADKVLVPITVGHTYKQAFADLQKAGLIPQVVAGPQDDNAIVMNSNPGSGQVE
PNTVVQLWTRPGDKQQPTTPGGNN
Download sequence
Identical sequences E4MZG2
gi|357390851|ref|YP_004905692.1| WP_014137041.1.24815 WP_014137041.1.28511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]