SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357391048|ref|YP_004905889.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|357391048|ref|YP_004905889.1|
Domain Number - Region: 6-48
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0186
Family beta-sandwich domain of Sec23/24 0.022
Further Details:      
 
Domain Number - Region: 70-131
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 0.0734
Family N-acetylmuramoyl-L-alanine amidase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357391048|ref|YP_004905889.1|
Sequence length 163
Comment hypothetical protein KSE_41470 [Kitasatospora setae KM-6054]
Sequence
MYGYEQSAYQDPYQQQQMQQGMSGMPGPGYGDPQAAQQSLYPEPSPPSLADAVRAFTTGA
MPVEDFQAIFITSKVYCPRGDRPGFLALHNTPTPVIPMFSSLKELKRYAGKESKHFSVTG
AEILDLLPTGYGFALDMEGEHRMVFDARAVEQMVDFTMRRMYG
Download sequence
Identical sequences E4MZJ9
gi|357391048|ref|YP_004905889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]