SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357391804|ref|YP_004906645.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357391804|ref|YP_004906645.1|
Domain Number 1 Region: 50-375,447-492
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.11e-78
Family Type II chitinase 0.000000163
Further Details:      
 
Domain Number 2 Region: 563-690
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000714
Family CBM22 0.084
Further Details:      
 
Domain Number 3 Region: 377-447
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000789
Family Chitinase insertion domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357391804|ref|YP_004906645.1|
Sequence length 691
Comment chitinase [Kitasatospora setae KM-6054]
Sequence
MTGERHIRMHRNNRRAWAVTAAAATLLAGAVSLLGAPSATAGPGNTTGAPATSGGIKVAY
FDQWSIYSNAFYLKNVDTNGMAGKLDYLLYDFANIDPNNLTCFEPNSAASQDENNPNAGD
GAGDYYADYAKTFANGNSVDNSTDTWNQPLAGNFHQLQELKAKYPKLKVLMSIGGWTYSK
YFSDVAASDAARKKFVSSCVDMFIKGNLPAQGGYGGPGTGKGIFDGFDIDWEYPGGGGHL
GNHASPNDKQNFTALLAEFRSQLNTQGTADSKTYALSAALPAGQDKIQYIETDKIGQYLT
FADPMTYDMHGGWEAQGPTNHQTPIYQNPNDPMNNVPPGNAKYSIDEAIKAYTVGDSSYG
IPGGFPANKLNMGVPLYYRGWTGVAAGANHGLFQPASGPAQGAPNSGNVNGVRMYKELLG
TVDNPSYTYWDPASQAAYFYDGNNFWSGENAKSIQAKLDYAHCNGLGGSFVFSLYDDPNA
ALLNPLVNATNGSAASCPAPPTGSPTATPTGPTSTPTGPTSSPTGPTSSPTGPTSSPTGP
TSSPTGPTSSPTGPTSSPTSGGGIVVNPGLETGALSPWTCAGSGGAAVSGGHTGSYALQG
NASAGDTAQCQQVVTVKPNTTYTLSAWVKGNYTYLGVTGSGADSSTWTPGGSAWTKLSTK
FTTGASVTSVTVWVHGWYGQGAYQADDFSVS
Download sequence
Identical sequences E4NGQ9
gi|357391804|ref|YP_004906645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]