SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357392752|ref|YP_004907593.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357392752|ref|YP_004907593.1|
Domain Number 1 Region: 51-354
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 6.8e-67
Family Nitrous oxide reductase, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357392752|ref|YP_004907593.1|
Sequence length 414
Comment hypothetical protein KSE_58670 [Kitasatospora setae KM-6054]
Sequence
MTADGSDPRGGVAGLAPAVAAAVATAVALGALGVVAPGSAAHAQERPGGEAAAHRLVYLA
NTRANSVTAYDPVTASPVATVQVGSYPQAVAVSPDGSQAYVVNNGSGTVSVLDTATGTVA
ATIAVGRLPGPVAFSPDGARAYVGHYVSPRAGGVDVIDTATRTVTATVPVGSQPFGIAVT
PDGGRVYVANLIGGSVSVIDAATDSLTGTIVDSRARMPAALAVAPDGGRVYVANYGSGNL
SVIDTASGAVSGVITVGAGPGGVSLSPDGARAYVPSQSDDTVSVVDTGAGRVTATVPVGA
TPIGVLADPAGGAVYVANSKDGTLSVLDPATDTVSRTVPTGSSPYQLATATVAPTVTGVR
AGHGPDAGGPPRFEPDARGYAYVWKTDRAYAGSCRVFALGLTDGTVHTALFDFD
Download sequence
Identical sequences E4N0F3 Q6L8I4
gi|357392752|ref|YP_004907593.1| WP_014138934.1.24815 WP_014138934.1.28511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]