SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357392895|ref|YP_004907736.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357392895|ref|YP_004907736.1|
Domain Number 1 Region: 696-771
Classification Level Classification E-value
Superfamily PKD domain 2.09e-17
Family PKD domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357392895|ref|YP_004907736.1|
Sequence length 891
Comment putative microbial collagenase precursor [Kitasatospora setae KM-6054]
Sequence
MRLRISLPTLAAGLVAGCTVAATLLPVTAAGAAPAGQNAKPSAAASGQNAPASAVDPKAP
GGAVPKPLGPIVDAAPDTLTPVAAPLPPALLVQSQMGQPKGTTVQTTPRPAKQNAGKGLL
AKSGGTSGGSPLAGAPGAEAGAAGAQAAAAQTCAYTDFGSRSGADLVNFVKGSTNTCVNT
LYNVTGTDAGAIFKQANMVTVANAFKDLAAGYDGTNASGILQLVQFLRAGYYVQSYYPSQ
VGSYDGTLTAATKAGLDAFFAGTRWKDVTTANGVVLYDVLVLTDSANIQAKYLDVYKQVL
NGYDNSYNATPKMVNAVNSVLFAPLWRGNWNTDFVNAVSADTSLVTTLGNFALNHRDLMG
TSNAFLDVNAGNDISRIAGSSTNAENAAKPLIKQLLDTTAILGSTGPLYVHVAYNANYYD
KGQCSYYGTCDLPKKLADTVLPNVLVCDNKTLRAQALTVAQLQPVCDSLRGEDTFFHNLV
KDNGPVPNQYGKTVVMPVFASAADYQTYSWAIYGNSTDNGGQTVMDVTDPNNQPVCVMYQ
KSWNDDFPGNVWNLNHEYTHYLDNIYDMSGNFASETSVPDIWWIEGVAEYQSYTYRGVTD
TQAMTEAAKHTYKLSTIFQNTYNNSDSTRVYPWGYLAVRYMFEKHPADVYNMLGHFRTGD
YQGGYAVYNGLGTSYDADFDAWLDQCANGACFATGPTALFNQSVNGATVTLTDRSVVTNS
PAQITGWHWTFGDGGTSEERNPSHTYAKAGTYTVALTVTDANGRTTATPSSVTTTVDASA
TLPTCADQRTDAMGQNCQRTGRARAAGDTDYMYIYLPAGTSTLKVTANGGTGTAYLYYNE
DTWASPSAFTASSTTQGTAQTITVNNPTAGYRYLSLYAVTDFANVTISTQF
Download sequence
Identical sequences E4N0U6
WP_014139076.1.24815 WP_014139076.1.28511 gi|357392895|ref|YP_004907736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]