SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357393007|ref|YP_004907848.1| from Kitasatospora setae KM-6054

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357393007|ref|YP_004907848.1|
Domain Number 1 Region: 3-364
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.28e-110
Family FMN-linked oxidoreductases 0.00000000128
Further Details:      
 
Domain Number 2 Region: 335-522
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.24e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000938
Further Details:      
 
Domain Number 3 Region: 469-623
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.8e-21
Family C-terminal domain of adrenodoxin reductase-like 0.0000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357393007|ref|YP_004907848.1|
Sequence length 668
Comment putative 2,4-dienoyl-CoA reductase [Kitasatospora setae KM-6054]
Sequence
MTAAYPHLLAPLDLGFTTLPNRVVMGSMHVGLEEAADGFERMAAFYAERARGGVGLIVTG
GIAPNEAGRPWGGGAKLTTEAEAAEHRVVTDAVHAAGGRIALQILHFGRYAYHDGLVAPS
ALQAPISPHVPHELTAEQVEQTVEDFARCAELARAAGYDGVEVMGSEGYLINEFVAARTN
HRTDEWGGPYENRMRFPVEIVRRVRERVGPDFILIYRLSMLDLVPGGSTFDEVVRLAREV
EAAGATIINTGIGWHEARIPTIATSVPRGAYAWVTRKLMGKVGIPLVATNRINTPETAED
LLATGHADLVSLARPMLADPAFVTKAAAGTPEAINTCIGCNQACLDHTFSARITSCLVNP
RACHETELVLAPTRRAKRIAVVGAGPAGLAFATAAADRGHRVTLFDAAAEVGGQLNVARK
VPGKQEFDETLRYYRHELARTGVELRLGAVVGPDLLTGWDEVVLATGVTPRVPDIEGVDH
PSVLGYLDVLQGGAKVGDTVAVIGAGGIGFDVAEYLTDPGADAPDFLARWGVDRAYAAPG
GLAEPERPASPRRVFLLQRKDGKVGAGLGKTTGWIHRTELRHRGVVSVPGVEYRRIDDHG
LHVTVGGEERTLPVDTVVLCAGQEPRRDLLAALRERGVEPHLIGGADVAAELDAKRAIDQ
GTRLAAAL
Download sequence
Identical sequences E4N158
WP_014139188.1.24815 WP_014139188.1.28511 gi|357393007|ref|YP_004907848.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]