SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397657123|ref|YP_006497825.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397657123|ref|YP_006497825.1|
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily YccV-like 4.32e-30
Family YccV-like 0.00000578
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397657123|ref|YP_006497825.1|
Sequence length 105
Comment hemimethylated DNA binding protein YccV [Klebsiella oxytoca E718]
Sequence
MIASKFGIGQQVRHTLLGYLGVIVDVDPEYSLTEPEEDEIAANDELRLAPWYHVVMEDDD
GQPIHTYLAEAQLSSEPSDEHPEQPSLDELARTIRQQLQAPRLRN
Download sequence
Identical sequences A0A068HA27 A0A0G3SA27 A0A0H3HBU3 A0A0J2I4E5 A0A1D8JRY0 A0A1F2HYL9 J5W3M4
WP_009651933.1.101164 WP_009651933.1.102027 WP_009651933.1.10264 WP_009651933.1.10517 WP_009651933.1.12043 WP_009651933.1.12607 WP_009651933.1.12666 WP_009651933.1.16033 WP_009651933.1.16221 WP_009651933.1.17303 WP_009651933.1.18200 WP_009651933.1.18452 WP_009651933.1.20013 WP_009651933.1.20800 WP_009651933.1.21019 WP_009651933.1.2675 WP_009651933.1.27905 WP_009651933.1.31371 WP_009651933.1.36474 WP_009651933.1.36477 WP_009651933.1.37412 WP_009651933.1.40069 WP_009651933.1.40108 WP_009651933.1.41184 WP_009651933.1.45119 WP_009651933.1.51564 WP_009651933.1.53171 WP_009651933.1.56052 WP_009651933.1.56093 WP_009651933.1.62898 WP_009651933.1.63981 WP_009651933.1.64237 WP_009651933.1.67927 WP_009651933.1.6818 WP_009651933.1.68620 WP_009651933.1.71148 WP_009651933.1.72569 WP_009651933.1.75060 WP_009651933.1.80555 WP_009651933.1.8153 WP_009651933.1.83138 WP_009651933.1.88526 WP_009651933.1.89623 WP_009651933.1.92088 WP_009651933.1.92269 WP_009651933.1.98530 gi|375260046|ref|YP_005019216.1| gi|397657123|ref|YP_006497825.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]