SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397657860|ref|YP_006498562.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397657860|ref|YP_006498562.1|
Domain Number 1 Region: 45-274
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.42e-38
Family Phosphate binding protein-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397657860|ref|YP_006498562.1|
Sequence length 292
Comment periplasmic binding protein [Klebsiella oxytoca E718]
Sequence
MALTLLSLSAASQAAIDLRANEQPLPVTRDEQAIAKIPANYAFVEPGTLTVAISALNSPP
LALLASDNRTRIGSDPDIARLLAGSLGLKLKLVPTAWEDWPLGITSGRYDVALVNIAVTE
QRKEKFDFATYRVDSLAFSVKSTSDIARVSGPADLAGKKVIVGSGTNQERILLGWNAENE
AAGRQPALPVYLTDDASGNLYIQSGRADVFFGPQSVAAYKAALSGKTKVVGLGPKKAYVA
TTTKKGNGLAPALQAALNGAIARGEYQKVLARWGEQGEEVTQSEVNPPGITY
Download sequence
Identical sequences A0A0H3HGP6
gi|375260770|ref|YP_005019940.1| gi|397657860|ref|YP_006498562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]