SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397657924|ref|YP_006498626.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397657924|ref|YP_006498626.1|
Domain Number 1 Region: 94-305
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.33e-39
Family Phosphate binding protein-like 0.017
Further Details:      
 
Domain Number 2 Region: 7-117
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.7e-20
Family LysR-like transcriptional regulators 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397657924|ref|YP_006498626.1|
Sequence length 310
Comment transcriptional regulator [Klebsiella oxytoca E718]
Sequence
MSDAGNVNFRALQLFIAVYDSQSFSVVARREGVSPSMVSRVIHQLEDALGQQLFYRNTRA
VVPTEAGRLFAEHARGLGERFSVARRDLQDRRLEPGGLVRINAPVYFGQRHIAPWLPGLT
QRYPQMQIALALTDDFIDPHREATDLIFRIGSLPDSSVHARVLGMQHHYLVAAPDYLQRC
GTPEKPEDLRHHSTLVYSGSNGPNRWLFRLAEGEWVHYPQTPRLASNNADALLTAALGGM
GVVLFPDWMVNEAMGAGRLVQLMPHYSAAIGSSSSPVSAIYPHARHPSLNVRAVIDYFID
VFGTPLYWQR
Download sequence
Identical sequences A0A249WPR3
WP_014838450.1.18452 WP_014838450.1.6818 gi|397657924|ref|YP_006498626.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]