SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397659799|ref|YP_006500501.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397659799|ref|YP_006500501.1|
Domain Number 1 Region: 93-289
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.76e-28
Family Phosphate binding protein-like 0.0035
Further Details:      
 
Domain Number 2 Region: 6-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.09e-20
Family LysR-like transcriptional regulators 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397659799|ref|YP_006500501.1|
Sequence length 290
Comment DNA binding protein HpkR [Klebsiella oxytoca E718]
Sequence
MRYSPEALTAFVESVACGSFSAAARRLRKSQSTISTAIANLEADLGVTLFDRTSRQPTLT
PQGEQVLSYVKAILAASDRLDELAISLSGNTEARLTFVLSDTLHPDVLEDLLAQFDRRFP
HTEFECLIGEDDDVIDLLQKERAQVGLIEARDSYPTEIGSIRLPMQTEMAIFVAPRHPLA
AQGSVTRDELFSWRELRLSTYLENTAEPARGLVWSAPNYLLLFSMAAQGLGWCILPSALV
EEFAGSGSLVALDIAGWPRMISTDLLWNKKAPPGEAGSWLRQHLQGHGRE
Download sequence
Identical sequences A0A068HHS5 A0A0G3S2Z3 A0A0H3GY31 A0A0J2HFN6 A0A1F2HIZ3
WP_014226691.1.100056 WP_014226691.1.101164 WP_014226691.1.102027 WP_014226691.1.12043 WP_014226691.1.12607 WP_014226691.1.13288 WP_014226691.1.16221 WP_014226691.1.17303 WP_014226691.1.18200 WP_014226691.1.18452 WP_014226691.1.20013 WP_014226691.1.31371 WP_014226691.1.35980 WP_014226691.1.36474 WP_014226691.1.36477 WP_014226691.1.37412 WP_014226691.1.40069 WP_014226691.1.40108 WP_014226691.1.41184 WP_014226691.1.45077 WP_014226691.1.45119 WP_014226691.1.48038 WP_014226691.1.53171 WP_014226691.1.56052 WP_014226691.1.56093 WP_014226691.1.62898 WP_014226691.1.63855 WP_014226691.1.64237 WP_014226691.1.67927 WP_014226691.1.6818 WP_014226691.1.68620 WP_014226691.1.72569 WP_014226691.1.80555 WP_014226691.1.83138 WP_014226691.1.88526 WP_014226691.1.89623 WP_014226691.1.92269 WP_014226691.1.98530 gi|375257175|ref|YP_005016345.1| gi|397659799|ref|YP_006500501.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]