SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397660081|ref|YP_006500783.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397660081|ref|YP_006500783.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 5.36e-108
Family FMN-linked oxidoreductases 0.0000000000683
Further Details:      
 
Domain Number 2 Region: 334-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.77e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000152
Further Details:      
 
Domain Number 3 Region: 461-519,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.78e-26
Family C-terminal domain of adrenodoxin reductase-like 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397660081|ref|YP_006500783.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [Klebsiella oxytoca E718]
Sequence
MSRYPSLFAPLDLGFTTLKNRVLMGSMHTGLEELPDGAQRLAAFYAERARHGVALIVTGG
IAPAPSGVTMAGGAVLNDASHLAHHRHITDAVHEEGGKIALQILHTGRYSYQPQLVAPSA
LQAPINPFTPHELSHEEILQLIDDFARCAQLAREAGYDGVEVMGSEGYLINEFLAARTNL
RDDQWGGDYARRMRFAVEVVRAVRERAGSDFIIVYRLSMLDLVSGGSTLAEVTALAKAIE
AAGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGAVSIPLVTTNRINDPAVAEAI
LARGDADMVSMARPFLADSEFLSKAQSGRADEINTCIGCNQACLDRIFAGKVTSCLVNPR
ACHETLMPIAPATAPKRLAVVGAGPAGLAFAVNAASRGHQVTLFDGHHEIGGQFTIAKQI
PGKEEFHETLRYYRRMLDLTGVALRLKTRVTADDLRAFDEIILATGIAPRMPDIAGIDHP
KVLSYLDVLRDKAPVGEKVAIIGCGGIGFDTAMYLSQSGVATSQNIDEFCAEWGIDTSLQ
SAGGLRPEGMQLAKSPRQIVMLQRKTSKPGDGLGKTTGWIHRATLLARGVKMIPGVSYQR
IDDAGLHVTIGGESQVLNVDHVIICAGQDPRRELADPLQTAGKTVHLIGGCDVAMELDAR
RAIAQGTRLALSI
Download sequence
Identical sequences A0A249WKU5
WP_014839607.1.18452 WP_014839607.1.6818 gi|397660081|ref|YP_006500783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]