SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397655384|ref|YP_006496086.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397655384|ref|YP_006496086.1|
Domain Number 1 Region: 29-395
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.4e-96
Family Phosphate binding protein-like 0.00000000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397655384|ref|YP_006496086.1|
Sequence length 396
Comment maltose/maltodextrin ABC transporter [Klebsiella oxytoca E718]
Sequence
MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIK
VSVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTW
DAVRYNGKLIAYPVAVEALSLIYNKDLVPNPPKTWEEIPALDKELKAKGKSALMFNLQEP
YFTWPLIAADGGYAFKFENGKYDVKDVGVDSAGAKAGLTFLVDLIKNKHMNADTDYSIAE
AAFNKGETAMTINGPWAWSNIDKSKVNYGVTLLPTFKGNPSKPFVGVLSAGINAASPNKE
LAKEFLENYLMTDQGLDEVNKDKPLGAVALKSFQEKLEKDPRIAATMANAQKGEIMPNIP
QMSAFWYAVRTAVINAASGRQTVDAALKDAQARITK
Download sequence
Identical sequences A0A068H5F9 A0A0G3RZJ6 A0A0H3H6V3 A0A0J2K701 A0A1D8JM62 A0A1F2I0A9
gi|375258441|ref|YP_005017611.1| WP_014227534.1.100056 WP_014227534.1.101164 WP_014227534.1.102027 WP_014227534.1.10517 WP_014227534.1.12043 WP_014227534.1.12607 WP_014227534.1.12666 WP_014227534.1.13288 WP_014227534.1.16033 WP_014227534.1.16221 WP_014227534.1.17303 WP_014227534.1.18200 WP_014227534.1.18452 WP_014227534.1.20013 WP_014227534.1.20800 WP_014227534.1.21019 WP_014227534.1.2675 WP_014227534.1.27905 WP_014227534.1.31371 WP_014227534.1.35980 WP_014227534.1.36474 WP_014227534.1.36477 WP_014227534.1.37412 WP_014227534.1.40069 WP_014227534.1.40108 WP_014227534.1.41184 WP_014227534.1.45077 WP_014227534.1.45119 WP_014227534.1.48038 WP_014227534.1.53171 WP_014227534.1.56052 WP_014227534.1.56093 WP_014227534.1.62898 WP_014227534.1.63855 WP_014227534.1.63981 WP_014227534.1.64237 WP_014227534.1.67927 WP_014227534.1.6818 WP_014227534.1.68620 WP_014227534.1.72569 WP_014227534.1.75060 WP_014227534.1.80555 WP_014227534.1.8153 WP_014227534.1.83138 WP_014227534.1.88526 WP_014227534.1.89623 WP_014227534.1.92088 WP_014227534.1.92269 WP_014227534.1.98530 gi|397655384|ref|YP_006496086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]