SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397655506|ref|YP_006496208.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397655506|ref|YP_006496208.1|
Domain Number 1 Region: 1-242
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.7e-61
Family Phosphate binding protein-like 0.0000579
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397655506|ref|YP_006496208.1|
Sequence length 243
Comment arginine-binding periplasmic protein [Klebsiella oxytoca E718]
Sequence
MKKALTVLLLATLATGTASATTLHFGTTTANPPYETVNGKNQPTGFDIDLANALCRQMQV
ECKFTPQGFDTLIPALRFKKFDALIAGIEVIPMREKQVAFSHPYRQALSGVVVTAKDAAH
TFADLKDKKIGVVKGTLHQHYLREKQKAVHAVPYDSDESALSALKEGVISGVMGDQETLT
KWLQDNPDYAMMDERATDPGYYGKQYAIAVRKDDPELLNNINAALDVVKASPEFQAMEQK
WFK
Download sequence
Identical sequences A0A0H3H5C0
gi|375258557|ref|YP_005017727.1| gi|397655506|ref|YP_006496208.1| WP_014227616.1.12607 WP_014227616.1.31371 WP_014227616.1.56093 WP_014227616.1.64237 WP_014227616.1.6818 WP_014227616.1.88526 WP_014227616.1.92269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]