SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397656188|ref|YP_006496890.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397656188|ref|YP_006496890.1|
Domain Number 1 Region: 29-268
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.23e-38
Family Phosphate binding protein-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397656188|ref|YP_006496890.1|
Sequence length 355
Comment alkanesulfonates-binding protein [Klebsiella oxytoca E718]
Sequence
MMKAFFSRTVLALVAVIGLAASAQAEALRTIRIGVPDQSAGSKPFIEGPVGMAFIRHQLE
EAFKPQGVEVQWQFFKGAGPAVNEALANRQLDFVYLGDLAAIIGKANGLPTRLLLGSRGS
ESWLAVTKASGIKTLADLKGKRVAVYRGTADQLAFDRALQTVGLNERSLQTINLDWNAGK
AALAAGRVDAVWGGVSLLALRGDKIDVVVKSGDSGRQNTTQAGFLGTQAFIDAWPQATQQ
IVNVLVKNAAEISDPANRDAWSAEMAQQSQIPQALFLEELQPQDLNFTTSPRIDPFLTDS
FSNSVEQAKSGRLIRSAFDVSQWVDGQFVEQALKAQGLENRWPQYDAKGQAKNAG
Download sequence
Identical sequences A0A0G3SCB4 A0A0J2LDN0
gi|397656188|ref|YP_006496890.1| WP_014837527.1.101164 WP_014837527.1.12043 WP_014837527.1.18452 WP_014837527.1.36477 WP_014837527.1.40108 WP_014837527.1.41184 WP_014837527.1.53171 WP_014837527.1.62898 WP_014837527.1.67927 WP_014837527.1.6818 WP_014837527.1.80555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]