SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397656232|ref|YP_006496934.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397656232|ref|YP_006496934.1|
Domain Number 1 Region: 34-305
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.89e-47
Family Phosphate binding protein-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397656232|ref|YP_006496934.1|
Sequence length 320
Comment Taurine-binding periplasmic protein TauA [Klebsiella oxytoca E718]
Sequence
MVFSSRITLIAALALAAFQAQAVNVTVAYQTSAEPAKVAQADNTFAKASGATVDWRKFDS
GASIVRALASGDVQIGNLGSSPLAVAATQQVPIEVFLLASKLGNSEALVVKKSITKPQDL
IGKRIAVPFISTTHYSLLSALKHWGIKPGQVQILNLQPPAIIAAWQRGDIDGAYVWAPAV
NALEKDGTVLTDSSQVGEWGAPTLDVWVVRKDFAEKHPDIVKAFAKSAIDAQQPYIANPD
EWLKQPENISKLARLSGVPEADVPGLVKGNTYLTAAQQAQELNGPVNKAIIDTAKFLKEQ
GKVPAAGSDYSQYVTDRFVK
Download sequence
Identical sequences A0A068HDZ8 A0A169DHS9 A0A1F2HDS3 A0A249WEF0 J4WQI8
gi|397656232|ref|YP_006496934.1| WP_004848133.1.102027 WP_004848133.1.10264 WP_004848133.1.12043 WP_004848133.1.12666 WP_004848133.1.16221 WP_004848133.1.17303 WP_004848133.1.18452 WP_004848133.1.20013 WP_004848133.1.21019 WP_004848133.1.2675 WP_004848133.1.27905 WP_004848133.1.37113 WP_004848133.1.37412 WP_004848133.1.40069 WP_004848133.1.41184 WP_004848133.1.45119 WP_004848133.1.51564 WP_004848133.1.53171 WP_004848133.1.56052 WP_004848133.1.61996 WP_004848133.1.63981 WP_004848133.1.6818 WP_004848133.1.68620 WP_004848133.1.71148 WP_004848133.1.72569 WP_004848133.1.73975 WP_004848133.1.83138 WP_004848133.1.85983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]