SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397656612|ref|YP_006497314.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397656612|ref|YP_006497314.1|
Domain Number 1 Region: 1-261
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.32e-53
Family Phosphate binding protein-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397656612|ref|YP_006497314.1|
Sequence length 283
Comment glutamine ABC transporter substrate-binding protein [Klebsiella oxytoca E718]
Sequence
MKKSLGSICLGAIMAMAFSYHAAAADLPEIEKSGTLKVATEDDYAPFNFMNNGQADGFNK
DMLDELRKYAKFNVDQSILPWTGLLAAVSTGQYDMALTGAVITDDRLKVFDFTPPWASAQ
HYFVKRAGDNSLNTIAELSGKKVGVQAGSALLARLPELKAMLEKTGGKLGPVVEYPSYPE
AYADLANKRLDYVINVVISVNDLAKAKPKVFAKGLAVSGPGYMAWPIPKNSPQLLAYMTK
FMNHMKETGKLAELQKKWFGETYDDLPNVPITSPEQFHKLAGL
Download sequence
Identical sequences A0A0G3SBE6 A0A0H3H7K5 A0A0J2I8F6 A0A1D8JQJ7 A0A1F2H4H2
gi|375259543|ref|YP_005018713.1| WP_004848610.1.101164 WP_004848610.1.102027 WP_004848610.1.10264 WP_004848610.1.10517 WP_004848610.1.12043 WP_004848610.1.12607 WP_004848610.1.12666 WP_004848610.1.13288 WP_004848610.1.16033 WP_004848610.1.17303 WP_004848610.1.18200 WP_004848610.1.18452 WP_004848610.1.20800 WP_004848610.1.21019 WP_004848610.1.2675 WP_004848610.1.27905 WP_004848610.1.31371 WP_004848610.1.35980 WP_004848610.1.36474 WP_004848610.1.36477 WP_004848610.1.37113 WP_004848610.1.37412 WP_004848610.1.40069 WP_004848610.1.41184 WP_004848610.1.51564 WP_004848610.1.53171 WP_004848610.1.56052 WP_004848610.1.56093 WP_004848610.1.61996 WP_004848610.1.62898 WP_004848610.1.63981 WP_004848610.1.64237 WP_004848610.1.67927 WP_004848610.1.6818 WP_004848610.1.68620 WP_004848610.1.72569 WP_004848610.1.73975 WP_004848610.1.75060 WP_004848610.1.8153 WP_004848610.1.83138 WP_004848610.1.85983 WP_004848610.1.88526 WP_004848610.1.89623 WP_004848610.1.92088 WP_004848610.1.92269 WP_004848610.1.98530 gi|397656612|ref|YP_006497314.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]