SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397656883|ref|YP_006497585.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397656883|ref|YP_006497585.1|
Domain Number 1 Region: 8-245
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.2e-75
Family Phosphate binding protein-like 0.0000000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397656883|ref|YP_006497585.1|
Sequence length 248
Comment glutamine ABC transporter [Klebsiella oxytoca E718]
Sequence
MKSVFKVSLAALTLAFAVSSHAADKTLVVATDTAFVPFEFKQGDKYVGFDVDLWAAIAKE
LKLDYTLKPMDFSGIIPALQTKNIDLALAGITITDERKKAIDFSDGYYKSGLLVMVNANN
NDIKDVKDLNGKVVAVKGGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTGRADAVLHDT
PNILYFIKTAGNGKFKAVGDSLEAQNYGIAFPKGSDELREKVNGALKTLRENGTYNEIYK
KWFGTEPK
Download sequence
Identical sequences A0A068HFL6 A0A0G3SFK2 A0A0H3HE77 A0A0J2LBE2 A0A1D8JRD2 A0A1F2HAX0 J6HVT3
WP_004849110.1.100056 WP_004849110.1.101164 WP_004849110.1.102027 WP_004849110.1.10264 WP_004849110.1.10517 WP_004849110.1.12043 WP_004849110.1.12607 WP_004849110.1.12666 WP_004849110.1.13288 WP_004849110.1.16033 WP_004849110.1.16221 WP_004849110.1.17303 WP_004849110.1.18200 WP_004849110.1.18452 WP_004849110.1.20013 WP_004849110.1.20800 WP_004849110.1.21019 WP_004849110.1.2675 WP_004849110.1.27905 WP_004849110.1.31371 WP_004849110.1.35980 WP_004849110.1.36474 WP_004849110.1.36477 WP_004849110.1.37113 WP_004849110.1.37412 WP_004849110.1.40069 WP_004849110.1.40108 WP_004849110.1.41184 WP_004849110.1.45077 WP_004849110.1.45119 WP_004849110.1.48038 WP_004849110.1.51564 WP_004849110.1.53171 WP_004849110.1.56052 WP_004849110.1.56093 WP_004849110.1.61996 WP_004849110.1.62898 WP_004849110.1.63855 WP_004849110.1.64237 WP_004849110.1.67927 WP_004849110.1.6818 WP_004849110.1.68620 WP_004849110.1.71148 WP_004849110.1.72569 WP_004849110.1.73975 WP_004849110.1.75060 WP_004849110.1.80555 WP_004849110.1.8153 WP_004849110.1.83138 WP_004849110.1.85983 WP_004849110.1.88526 WP_004849110.1.89623 WP_004849110.1.92269 WP_004849110.1.98530 gi|375259819|ref|YP_005018989.1| gi|397656883|ref|YP_006497585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]