SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397657008|ref|YP_006497710.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397657008|ref|YP_006497710.1|
Domain Number 1 Region: 29-369
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.99e-106
Family Phosphate binding protein-like 0.00000000000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397657008|ref|YP_006497710.1|
Sequence length 370
Comment putrescine ABC transporter putrescine-binding protein PotF [Klebsiella oxytoca E718]
Sequence
MTAFGKKWLTGLVTGALMAVSAGSLAAEQKTLHVYNWSDYIAPDTVANFEKETGIKVVYD
VFDSNEVLEGKLMAGSTGFDLVVPSASFLERQLAAGVFQPLDKSKLPNWKNLDPEVLKLV
AKHDPDNKYAIPYLWATTGIGYNIDKVKAVLGKDAPLDSWDLVMKPENLEKLKSCGVSFL
DAPEEIFATLLNYLGKDPNSTKADDYTGPATDLLLKLRPNIRYFHSSQYINDLANGDICV
AIGWAGDVWQAANRAKEAKNGVNVSYYIPKEGALAFFDVFAMPADAKNKDEAYQFLNYLM
RPEVIAHISDHVYYANGNKASVPLVSEAIRNNPAIYPPADVFAKLFTLKVQDPKIDRVRT
RAWTKVKSGK
Download sequence
Identical sequences A0A249WC63
gi|397657008|ref|YP_006497710.1| WP_014837938.1.18452 WP_014837938.1.6818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]