SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397657016|ref|YP_006497718.1| from Klebsiella oxytoca E718

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397657016|ref|YP_006497718.1|
Domain Number 1 Region: 1-242
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.7e-73
Family Phosphate binding protein-like 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397657016|ref|YP_006497718.1|
Sequence length 243
Comment Arginine ABC transporter [Klebsiella oxytoca E718]
Sequence
MKKLVLAALLSTFAFGAAAAEKISFGVSATYPPFESMDANNQIAGFDIDLANALCKQMQA
ECTFTNHAFDSLIPALKFKKYDAVISGMDITPERSKQVAFTDPYYANSALVISKKDAFHS
FADLKGKRIGMENGTTHQKYLQDKHPEVKTVAYDSYQNAFIDLKNGRIDGVFGDTAVVNE
WLKTNPQLGAATPKVTDAQYFGTGLGIAVRPDNKALLEKLNAALKAIKADGTYEKISKQW
FPE
Download sequence
Identical sequences A0A068H9S7 A0A0G3SD35 A0A0H3H954 A0A0J2I6C1 A0A1D8JRM2 A0A1F2HX15
WP_014228605.1.101164 WP_014228605.1.102027 WP_014228605.1.10517 WP_014228605.1.12043 WP_014228605.1.12607 WP_014228605.1.12666 WP_014228605.1.16033 WP_014228605.1.16221 WP_014228605.1.17303 WP_014228605.1.18200 WP_014228605.1.18452 WP_014228605.1.20013 WP_014228605.1.20800 WP_014228605.1.21019 WP_014228605.1.2675 WP_014228605.1.27905 WP_014228605.1.31371 WP_014228605.1.36474 WP_014228605.1.36477 WP_014228605.1.37412 WP_014228605.1.40069 WP_014228605.1.40108 WP_014228605.1.41184 WP_014228605.1.45119 WP_014228605.1.53171 WP_014228605.1.56052 WP_014228605.1.56093 WP_014228605.1.62898 WP_014228605.1.63981 WP_014228605.1.64237 WP_014228605.1.67927 WP_014228605.1.6818 WP_014228605.1.68620 WP_014228605.1.72569 WP_014228605.1.75060 WP_014228605.1.80555 WP_014228605.1.8153 WP_014228605.1.83138 WP_014228605.1.88526 WP_014228605.1.89623 WP_014228605.1.92088 WP_014228605.1.92269 WP_014228605.1.98530 gi|397657016|ref|YP_006497718.1| gi|375259937|ref|YP_005019107.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]